DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Ag3 and Cpr64Ac

DIOPT Version :10

Sequence 1:NP_652662.1 Gene:Lcp65Ag3 / 59159 FlyBaseID:FBgn0086611 Length:105 Species:Drosophila melanogaster
Sequence 2:XP_311662.4 Gene:Cpr64Ac / 1272756 VectorBaseID:AGAMI1_002251 Length:164 Species:Anopheles gambiae


Alignment Length:108 Identity:36/108 - (33%)
Similarity:46/108 - (42%) Gaps:27/108 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LFAVALAAPAAEEPTIVRSES-DVGPE-SFKY---DWETSDGQAAQAVGQLNDIGTENEAIS--- 66
            |.|.|:|..||  |.:...|: |..|. ||.|   |..|.|.:.|:            |.:|   
Mosquito    51 LHAPAIAVAAA--PVLKHVEAYDPNPHYSFSYGVSDPHTGDSKHAE------------ETLSNGV 101

  Fly    67 VSGSYRFIADDGQTYQVNYIADK-NGF----QPEGAHLPVAPV 104
            |.|||.....||...:|.|.||| :||    :..|..:..|||
Mosquito   102 VHGSYSLTEPDGTIRKVTYTADKIHGFNAVVEKSGHAIHTAPV 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65Ag3NP_652662.1 Chitin_bind_4 37..92 CDD:459790 19/61 (31%)
Cpr64AcXP_311662.4 Chitin_bind_4 76..128 CDD:459790 20/63 (32%)

Return to query results.
Submit another query.