DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Au and Cpr65Az

DIOPT Version :10

Sequence 1:NP_652661.1 Gene:Cpr65Au / 59158 FlyBaseID:FBgn0042119 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_648031.1 Gene:Cpr65Az / 38712 FlyBaseID:FBgn0035686 Length:239 Species:Drosophila melanogaster


Alignment Length:80 Identity:31/80 - (38%)
Similarity:48/80 - (60%) Gaps:3/80 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GEDAQAETIKLESE-NTGDKYSFAYETSNGISRTETGEVKPGAGEEDGSLSVQGSTSWSAPDGKK 86
            |||  ...|||||: ||...|.:.|||.|||...|.|.:|....|...:.:.:||.|:::|:|::
  Fly   111 GED--IPIIKLESKVNTDGSYMYEYETGNGIKAEEMGYLKNAGVEGAEAQTAEGSFSYTSPEGQE 173

  Fly    87 YEISFTADETGYHPK 101
            ..:::.|||.|:.|:
  Fly   174 ISLTYIADENGFQPQ 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AuNP_652661.1 Chitin_bind_4 42..98 CDD:459790 19/55 (35%)
Cpr65AzNP_648031.1 Chitin_bind_4 129..185 CDD:459790 19/55 (35%)

Return to query results.
Submit another query.