DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Au and Acp65Aa

DIOPT Version :8

Sequence 1:NP_001286953.1 Gene:Cpr65Au / 59158 FlyBaseID:FBgn0042119 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_477282.2 Gene:Acp65Aa / 38710 FlyBaseID:FBgn0020765 Length:105 Species:Drosophila melanogaster

Alignment Length:97 Identity:43/98 (44%)
Similarity:62/98 (63%) Gaps:3/98 (3%)


  Fly     6 MWLVAFLAIGICLAFPAGEDAQAETIKLESENTG-DKYSFAYETSNGISRTETGEVKPGAGEEDG 69
            |.:|..:|:.:.|| .|......|.::.|||||| ..|.|:|:.|:|.||||.|.|. .||.::.
  Fly     5 MLVVGSIALLLALA-SARPQNDVEVLEYESENTGLGGYKFSYKLSDGTSRTEEGVVN-NAGTDNE 67

  Fly    70 SLSVQGSTSWSAPDGKKYEISFTADETGYHPK 101
            |:|::||.:|.||||:.|.|:|.|||.|:.|:
  Fly    68 SISIRGSVTWVAPDGQTYTINFVADENGFQPE 99

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr65AuNP_001286953.1 Chitin_bind_4 42..98 CDD:278791 29/56 (52%)
Acp65AaNP_477282.2 Chitin_bind_4 41..96 CDD:278791 29/56 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10380
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.