DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Au and Lcp4

DIOPT Version :10

Sequence 1:NP_652661.1 Gene:Cpr65Au / 59158 FlyBaseID:FBgn0042119 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_476622.1 Gene:Lcp4 / 35820 FlyBaseID:FBgn0002535 Length:112 Species:Drosophila melanogaster


Alignment Length:98 Identity:25/98 - (25%)
Similarity:45/98 - (45%) Gaps:19/98 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LVAFLAIGICLAFPAGEDAQAETIKLESENTGDKYSFAYETSNGISRTETGEVKPGAGEEDGSLS 72
            |||.:|        |.|:.:.:  :|.::...|.:.......||.:.:.||:|..         :
  Fly    10 LVALVA--------ANENPEVK--ELVNDVQADGFVSKLVLDNGSAASATGDVHG---------N 55

  Fly    73 VQGSTSWSAPDGKKYEISFTADETGYHPKFRLV 105
            :.|...|.:|:|:...:|:.|||.||.|:..|:
  Fly    56 IDGVFEWVSPEGEHVRVSYKADENGYQPQSDLL 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AuNP_652661.1 Chitin_bind_4 42..98 CDD:459790 13/55 (24%)
Lcp4NP_476622.1 Chitin_bind_4 40..81 CDD:459790 13/49 (27%)

Return to query results.
Submit another query.