DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cpr65Au and Lcp1

Sequence 1:NP_001286953.1 Gene:Cpr65Au FlyBaseID:FBgn0042119 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_001260801.1 Gene:Lcp1 FlyBaseID:FBgn0002531 Length:130 Species:Drosophila melanogaster

Alignment Length:103 Identity:25/104 (24%)
Similarity:47/104 (45%) Gaps:16/104 (15%)


  Fly     5 FMWLVAFLAIGICLAFP-------AGEDAQAETIKLESENTGDKYSFAYETSNGISRTETGEVKP 62
            |.:::....:|:.:|.|       ..||..|:.:....:...|.:..:..|||||.:..:|    
  Fly     2 FKFVMICAVLGLAVANPPVPHSLGRSEDVHADVLSQSDDVRADGFDSSLHTSNGIEQAASG---- 62

  Fly    63 GAGEEDGSLSVQGSTSWSAPDGKKYEISFTADETGYHP 100
                 |...::.|:..|.:|:|:..|:.:.|:|.||.|
  Fly    63 -----DAHGNIHGNFGWISPEGEHVEVKYVANENGYQP 95

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr65AuNP_001286953.1 Chitin_bind_4 42..98 CDD:278791 15/56 (27%)
Lcp1NP_001260801.1 Chitin_bind_4 46..93 CDD:278791 15/56 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10380
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.