DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL36 and nae1

DIOPT Version :8

Sequence 1:NP_652658.1 Gene:mRpL36 / 59151 FlyBaseID:FBgn0042112 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_956793.1 Gene:nae1 / 573336 ZFINID:ZDB-GENE-040426-1552 Length:533 Species:Danio rerio

Alignment Length:65 Identity:18/66 (27%)
Similarity:23/66 (35%) Gaps:18/66 (27%)


  Fly    13 RLW--NGLSAARGFHLLTRPAAPAIVSIQSSQLVAAT-TGICQTSGLLTPGSTLVQQVAGFKVKG 74
            |||  :|..|....|:.               |:.|| :|......|:.||......|.|.||.|
Zfish    17 RLWGDHGQEALENAHVC---------------LINATASGTEILKNLVLPGIGAFTIVDGHKVSG 66

  Fly    75  74
            Zfish    67  66

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mRpL36NP_652658.1 Ribosomal_L36 70..105 CDD:278851 3/6 (50%)
nae1NP_956793.1 ThiF 6..>164 CDD:223552 18/66 (27%)
APPBP1_RUB 10..531 CDD:238770 18/66 (27%)
Interaction with uba3. {ECO:0000250} 330..343
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.