DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18744 and arrd-14

DIOPT Version :8

Sequence 1:NP_652647.2 Gene:CG18744 / 59140 FlyBaseID:FBgn0042101 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_496881.1 Gene:arrd-14 / 175021 WormBaseID:WBGene00011055 Length:356 Species:Caenorhabditis elegans

Alignment Length:349 Identity:79/350 (23%)
Similarity:135/350 (39%) Gaps:73/350 (21%)


  Fly     5 CEIQLDNPRGVYRAGDTVNGHVYLTLSERALIKAICLEANGYASTAWQQPQ--KHKNQKKNEQPV 67
            |:.|:...:.||..||.|.|..:::.::.....::.:..:|...||....:  |.|..||.|:. 
 Worm     6 CDPQISFEKEVYFPGDEVKGRAWVSTTKNLKATSVEITFSGKTITAHNGKKIIKDKKCKKGEET- 69

  Fly    68 VVQSLDFDYRVDYFAKIDYFVGSEAAQPQIMEAGTYNYGFHVKLPKNCPGNFEGGHGHIRYTLQV 132
                         :.::.:.|.:.........:|.|.:.|..:|||:||.:|||.:|.|||:  |
 Worm    70 -------------YVEMKHEVWTPEDTENTFPSGDYEWNFSFELPKDCPPSFEGKYGFIRYS--V 119

  Fly   133 LIHSSA--DRPLEV----------------------LHVRQLQIFPQNSLSQETRSCEIQIYEQT 173
            |:|.:.  .:|:.|                      :||..:..:........||...|      
 Worm   120 LLHIAVPNGKPINVERAVTVSSMVDLNAVNAHEPAKIHVDNVAEYCHCLPCLPTRGNVI------ 178

  Fly   174 PRLRFWMKPLHLQLQIPRQGYSPGAGISVHLKLHNPEKLTLREAVYSLVQISTYVAHLK---NKP 235
                       ..||.|:.||..|..:.|..::.|.....::.....|.:..||...||   |..
 Worm   179 -----------YTLQSPKCGYVAGENVIVSGQIENGTSKPMKIITAKLTRRITYREELKAKANAK 232

  Fly   236 KR------LETKVERQTVLSSRHELHNLPRGELQNFQHLHMLQVPQTAATLTVAGCACLQLNYEV 294
            |:      .::|:|.| :|.::.|..|:|....::|  .....:|  |...|:.....|.:.|.|
 Worm   233 KKADGADGFKSKLEEQ-ILETKIERCNVPARSSKDF--AFSFDIP--AVVSTIRSSRLLAVEYFV 292

  Fly   295 EVLVTTQQEKRLIAARMPVIIGNV 318
            .|...|....|...|.:.:|:|||
 Worm   293 TVWGDTGTCNRGGVAALNIIVGNV 316

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18744NP_652647.2 Arrestin_C 179..322 CDD:214976 37/150 (25%)
Arrestin_N 5..141 CDD:304627 35/140 (25%)
arrd-14NP_496881.1 Arrestin_N 6..146 CDD:278754 37/156 (24%)
Arrestin_C 173..318 CDD:214976 40/167 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D311636at33208
OrthoFinder 1 1.000 FOG0000069
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11188
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.