DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RABIF and strat

Sequence 1:NP_002862.2 Gene:RABIF HGNCID:9797 Length:123 Species:Homo sapiens
Sequence 2:NP_609209.2 Gene:strat FlyBaseID:FBgn0032020 Length:122 Species:Drosophila melanogaster

Alignment Length:117 Identity:46/118 (39%)
Similarity:75/118 (64%) Gaps:5/118 (4%)


Human     8 SELVSAEGRNRKAVLCQRCGSRVLQPGTALFSRRQLFLPSM-RKKPALSDGSNPDGDLLQEHWLV 71
            ||.:: :|:|:..|.||.|...:|:.....:::.::.:|.| :|:...:|..|  .:.|::.|||
  Fly     8 SEQIT-DGKNKSNVRCQFCNCLMLKAQEGTYNQEEVDVPLMTQKQDRTADSLN--SEPLKDFWLV 69

Human    72 EDMFIFENVGFTKDVGNIKFLVCADCEIGPIGWHCLDDKNSFYVALERVSHE 123
            :||..|||:||:..|...|||||||||.||:|:|.|..::. |:||:||.|:
  Fly    70 KDMMTFENIGFSNTVDGRKFLVCADCERGPVGYHDLSTRHC-YLALKRVVHK 120

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RABIFNP_002862.2 RabGEF 19..123 CDD:238150 42/105 (40%)
stratNP_609209.2 Mss4 34..119 CDD:282300 36/88 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C195844680
eggNOG 1 0.900 E1_KOG4113
Hieranoid 1 1.000
Homologene 1 1.000 H37702
Inparanoid 1 1.050 87 1.000 Inparanoid score I5065
Isobase 1 0.950 0 Normalized mean entropy S4823
OMA 1 1.010
OrthoDB 1 1.010 D1495679at2759
OrthoFinder 1 1.000 FOG0003385
OrthoInspector 1 1.000 T1074404
orthoMCL 1 0.900 OOG5_132853
Panther 1 1.100 LDO PTHR13276
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R754
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1514.750

Return to query results.
Submit another query.