DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PTPN12 and PTP-ER

Sequence 1:NP_002826.3 Gene:PTPN12 HGNCID:9645 Length:780 Species:Homo sapiens
Sequence 2:NP_726092.1 Gene:PTP-ER FlyBaseID:FBgn0016641 Length:1377 Species:Drosophila melanogaster

Alignment Length:527 Identity:124/528 (23%)
Similarity:177/528 (34%) Gaps:241/528 (46%)


Human     2 EQVEILRKFIQRVQAMKSP----DHNGEDNFARDFMRLRRLSTKY------RTEKIYPTATGEKE 56
            |..|:|..:...|..|..|    ..|.:....||      |..::      ..||  |...|.: 
  Fly   861 EDSELLASYQTVVSRMAQPIPELKENEQKRIFRD------LHKEFWDLPLNHQEK--PMVFGSQ- 916

Human    57 ENVKKNRYKDILPFDHSRVKLTLK-----------------TPSQDSDYINANFIKGV-YGPKAY 103
               .|||||.|||.::|||.|..:                 |.|:|..|||||:|||. |..|.|
  Fly   917 ---TKNRYKTILPNENSRVLLESESSELTSLLGEIKRTSSVTASEDLPYINANYIKGPDYVSKCY 978

Human   104 VATQGPLANTVIDFWRMIWEYN---------------------------VVIIVMACREFEMGRK 141
            |||||||.||:.:||.||::..                           ...|||.....|..|:
  Fly   979 VATQGPLPNTIFEFWLMIYQNTQRYIRRCVDGGSSSSPHVDREQILQQYFQKIVMLTNFTEANRQ 1043

Human   142 KCERYWPL-----------------------YGEDPI--TFAP---------------------- 159
            ||..|:|:                       |.:..:  ||.|                      
  Fly  1044 KCAVYFPIELNEIFAVAAKCEVFQLSAAARDYFDRYLTPTFVPDTVVASSDAIDYEISGRHIGVE 1108

Human   160 -FKISCEDE-------------------QARTDYFIRTLLLEF-----QNES---RRLYQFH--Y 194
             .|::.|.:                   ..|..|.:|.|:|.:     |:.|   :::|.:|  |
  Fly  1109 SVKVTLEGDLLEALPAQGSFFLIKNVGIVRRNGYSVRKLVLLYCIRVPQSASYHLQKIYCYHYWY 1173

Human   195 VNWPDHDVPSSFDSILD----MISL-------------------------MRKYQEH-----EDV 225
            .:||||..|...:::||    :::|                         :..||:.     :.:
  Fly  1174 PDWPDHHSPRDINTLLDTCLHVLNLGKCESEFDIYDDTRSERNAHLAAQRLEIYQQDIFNAVQPL 1238

Human   226 PICIHCSAGCGRTGAICAI---------------------------------------DYTWNLL 251
            |: ||||||.||||...||                                       .:|.|.:
  Fly  1239 PV-IHCSAGIGRTGCFTAILNAVRQLRQSLAYSLTGMLTKSLTSSSTEEYHNPTDSDSSFTCNTI 1302

Human   252 K------------AGKIPEEF-----------NVFNLIQEMRTQRHSAVQTKEQYELVHRAIAQL 293
            :            |.|.|..|           :|..::..:|.||...||..|||||:||||...
  Fly  1303 RHISHILDHRDAEAVKTPPSFDRLPKMPDIFVDVLGIVCNLRLQRGGMVQNSEQYELIHRAICLY 1367

Human   294 FEKQLQL 300
            .::.|.|
  Fly  1368 LKRTLAL 1374

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PTPN12NP_002826.3 PTPc 28..292 CDD:214550 115/488 (24%)
PTPc 60..292 CDD:238006 108/450 (24%)
Substrate binding. {ECO:0000305|PubMed:27134172} 63..67 3/4 (75%)
Substrate binding. {ECO:0000250} 231..237 5/6 (83%)
Interaction with TGFB1I1. {ECO:0000250} 345..438
PTP-ERNP_726092.1 Y_phosphatase 916..1364 CDD:278528 107/453 (24%)
PTPc 917..1364 CDD:238006 107/448 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.