DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: IGSF9 and DIP-epsilon

Sequence 1:NP_001128522.1 Gene:IGSF9 HGNCID:18132 Length:1179 Species:Homo sapiens
Sequence 2:NP_001137799.1 Gene:DIP-epsilon FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster

Alignment Length:393 Identity:95/394 (24%)
Similarity:149/394 (38%) Gaps:92/394 (23%)


Human     5 LGLAVLSLVISQGADGRGKPEVVSVVGR----AGESVVLGCDLLPPAGRPPLHVIEWLRF--GFL 63
            :|.:.|:.|||:      .||...|:..    ||.:|.|.|.:.....    :.:.|:.|  ..:
  Fly    39 VGGSTLNNVISE------DPEFTDVIENITVPAGRNVKLACSVKNLGS----YKVAWMHFEQSAI 93

Human    64 LPIFIQFGLYSPRIDPDYVGRVRLQKGAS--LQIEGLRVEDQGWYECRVFFLDQHIPEDDFANGS 126
            |.:.......:|||.   |...:..|..:  |.|..::.||:|.|.|::..:.        |...
  Fly    94 LTVHNHVITRNPRIS---VTHDKHDKHRTWFLHINNVQEEDRGRYMCQINTVT--------AKTQ 147

Human   127 WVHLTVNSPPQFQE--TPPAVLEVQELEPVTLRCVARGSPLPHVTWKLRGKDLGQGQGQVQVQNG 189
            :..:.|..||...:  |...:: |:|.:.|||||.|:|||.|.:.||       :..|...|.|.
  Fly   148 YGFVKVVVPPNIDDALTSSDII-VREGDNVTLRCKAKGSPEPTIKWK-------RDDGNKIVINK 204

Human   190 TLRI----------RRVERGSSGVYTCQASS-TEGSATHATQLLVLGPPVIVVPPKNSTVNASQD 243
            ||.:          .|:.|...|.|.|.||: ...|.:...::.|...|::.:|.:...:....:
  Fly   205 TLEVHDLETDSLELERISRLHMGAYLCIASNGVPPSVSKRIKVSVDFSPMVWIPHQLVGIPIGFN 269

Human   244 VSLACHAEAYPANLTYSWFQDNINVFHISRLQPRVRI----LVDGSLRLLAT--QPDDAGCYTCV 302
            ::|.|..||.|.:|.| |.::|..:...|.......|    ....::||..|  |..|.|.|.||
  Fly   270 ITLECFIEANPTSLNY-WTRENDQMITESSKYKTETIPGHPSYKATMRLTITNVQSSDYGNYKCV 333

Human   303 PSNG-----------LLHPPSASAYLTVLYPAQVTAMPP----------ETPLPIGMPGVIRCPV 346
            ..|.           :..||              |..||          .|...|.:.|.|..|:
  Fly   334 AKNPRGDMDGNIKLYMSSPP--------------TTQPPPTTTTLRRTTTTAAEIALDGYINTPL 384

Human   347 RAN 349
            ..|
  Fly   385 NGN 387

Known Domains:


GeneSequenceDomainRegion External IDIdentity
IGSF9NP_001128522.1 Ig 24..132 CDD:299845 24/116 (21%)
IG_like 28..110 CDD:214653 21/90 (23%)
I-set 136..223 CDD:254352 29/100 (29%)
Ig 154..220 CDD:143165 25/77 (32%)
Ig_3 226..305 CDD:290638 22/85 (26%)
IG_like 233..319 CDD:214653 23/103 (22%)
Ig 341..404 CDD:299845 3/10 (30%)
IG_like 431..503 CDD:214653
Ig 436..500 CDD:143165
fn3 511..596 CDD:278470
FN3 625..715 CDD:238020
PDZ-binding. {ECO:0000250} 1177..1179
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 22/111 (20%)
Ig 69..139 CDD:143165 18/77 (23%)
IG_like 165..249 CDD:214653 27/92 (29%)
IGc2 172..237 CDD:197706 25/72 (35%)
IG_like 267..348 CDD:214653 21/82 (26%)
Ig 270..339 CDD:299845 21/70 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.