DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: IGSF9 and DIP-delta

Sequence 1:NP_001128522.1 Gene:IGSF9 HGNCID:18132 Length:1179 Species:Homo sapiens
Sequence 2:NP_001097508.2 Gene:DIP-delta FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster

Alignment Length:438 Identity:99/439 (23%)
Similarity:169/439 (38%) Gaps:77/439 (18%)


Human    24 PEVVSVVGRAGESVVLGCDLLPPAGRPPLHVIEWLRFGFLLPIFIQFGLYS--PRIDPDYVGRVR 86
            |.|...|||...   |.|.:....|    :.:.|:.....:.:.|...:.|  ||....|.....
  Fly    51 PNVTVAVGRDAN---LPCVVEHLGG----YKVAWIHIDRQMILTIHRHVISRIPRYSITYTDNTW 108

Human    87 LQKGASLQIEGLRVEDQGWYECRVFFLDQHIPEDDFANGSWV-----HLTVNSPPQFQ--ETPPA 144
            |     |.:.....:|:|:|.|:|             |.:.:     :|.|..||...  |:.|:
  Fly   109 L-----LHVNQAHQDDRGYYMCQV-------------NTNPMISQVGYLQVVVPPNILDIESTPS 155

Human   145 VLEVQELEPVTLRCVARGSPLPHVTWKLR-GKDLG-QGQGQVQVQNG-TLRIRRVERGSSGVYTC 206
            .:.|:|.:.:.:.|.|.|.|.|.:.|:.. |:::. :.:.:|.|.:. .|.:.:|.|...|.|.|
  Fly   156 SVAVRENQNINMTCRADGFPAPKIIWRREDGEEIAVEKKKKVLVYDADVLPLTKVSRNEMGAYLC 220

Human   207 QASSTEGSATHATQLLVLG---PPVIVVPPKNSTVNA--SQDVSLACHAEAYPANLTYSWFQDNI 266
            .|  |.|.....::.::|.   .|:|.||  |..|.|  ..||::.||.||:|..:.| |..:::
  Fly   221 IA--TNGVPPSVSKRIILDVEFSPMIWVP--NQLVGAPSGTDVTIDCHTEAHPKAIIY-WVYNSV 280

Human   267 NVFHISRLQPRVRILVDGS---------LRLLATQPDDAGCYTCVPSNGLLHPPSASAYLTVLYP 322
            .|.      |..:...|.:         |.:...|..|.|.|.|:..|.|.....:.....:..|
  Fly   281 MVL------PSKKYKTDYTENSYRAHMKLTIRNLQYGDFGNYRCISKNSLGETEGSIRVYEIPLP 339

Human   323 AQVTAMPPETPLPIGMPGVIRCPVRANPPLLFVSWTKDGKALQLDKFPG-WSQGTEGSLIIALGN 386
            :..:.....|.:......:|  |...|.....:. |..|.|::.|.:|| .|..:.|....|..:
  Fly   340 STPSKQVTHTTVESRENNII--PSSRNDTTKSLQ-TDVGYAMKNDLYPGSASSSSSGGSSSAASS 401

Human   387 EDAL------GEYSCTPYNSLGTAGPSPVTRVLLKAPPAFIERPKEEY 428
            ..::      |..:....:|:|:.|...:.:...     :.|||..||
  Fly   402 SSSMQTSALPGGVAGNSLSSMGSKGSLAIGKSTF-----YTERPPNEY 444

Known Domains:


GeneSequenceDomainRegion External IDIdentity
IGSF9NP_001128522.1 Ig 24..132 CDD:299845 23/115 (20%)
IG_like 28..110 CDD:214653 18/84 (21%)
I-set 136..223 CDD:254352 23/92 (25%)
Ig 154..220 CDD:143165 18/69 (26%)
Ig_3 226..305 CDD:290638 25/90 (28%)
IG_like 233..319 CDD:214653 23/97 (24%)
Ig 341..404 CDD:299845 15/70 (21%)
IG_like 431..503 CDD:214653
Ig 436..500 CDD:143165
fn3 511..596 CDD:278470
FN3 625..715 CDD:238020
PDZ-binding. {ECO:0000250} 1177..1179
DIP-deltaNP_001097508.2 IG_like 51..143 CDD:214653 24/117 (21%)
Ig 53..143 CDD:299845 23/115 (20%)
Ig 144..224 CDD:299845 23/82 (28%)
I-set 150..238 CDD:254352 23/90 (26%)
I-set 242..333 CDD:254352 27/100 (27%)
Ig 259..332 CDD:143165 19/80 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.