DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: IGSF9 and dpr6

Sequence 1:NP_001128522.1 Gene:IGSF9 HGNCID:18132 Length:1179 Species:Homo sapiens
Sequence 2:NP_001287018.1 Gene:dpr6 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster

Alignment Length:284 Identity:54/285 (19%)
Similarity:104/285 (36%) Gaps:74/285 (26%)


Human   118 PEDDFANGSWVHLTVNSPPQFQETPPAVLEVQELEPVTLRCVARGSPLPHVTWKLRGKDLG---- 178
            |...:.:..|:.      |.|..:.|..:.....:...|.|..|......|:| :|.:|:.    
  Fly    61 PTAAYTHPKWME------PYFDPSTPRNVTALMGKSAYLSCRVRNLANKTVSW-IRHRDIHILTV 118

Human   179 -----------QGQGQVQVQNGTLRIRRVERGSSGVYTCQASSTEGSATHATQLLVLGPPVIVVP 232
                       |.......::.||:|:..::..:|:|.||. ||:...::..:|.|:.|...::.
  Fly   119 GSYTYTSDQRFQATHHQDTEDWTLQIKWAQKRDAGMYECQI-STQPVRSYFVRLNVVVPTATILG 182

Human   233 PKNSTVNASQDVSLACHAEAYPANLTYSWFQDNINVFHISRLQPRVRILVD-GSLR---LLATQP 293
            ..:..|:....::|.|..:..|....|.::..:..|.:....:..|.::.: |.:.   ||....
  Fly   183 GPDLHVDKGSTINLTCTVKFSPEPPAYIFWYHHEEVINYDSSRGGVSVITEKGDVTTSFLLIQNA 247

Human   294 D--DAGCYTCVPSNGLL-----------------HPPSASA--------YLTVL----------- 320
            |  |:|.|:|.|||..:                 ||.:...        :||::           
  Fly   248 DLADSGKYSCAPSNADVASVRVHVLNVRAIISGEHPEAMQTGSSGCQYNWLTIVLLLGLVLCYSS 312

Human   321 ------YPAQVTA---MPPETPLP 335
                  .||.:|:   :|.:.|||
  Fly   313 QQCSSAVPASLTSSLPLPSQLPLP 336

Known Domains:


GeneSequenceDomainRegion External IDIdentity
IGSF9NP_001128522.1 Ig 24..132 CDD:299845 2/14 (14%)
IG_like 28..110 CDD:214653
I-set 136..223 CDD:254352 21/102 (21%)
Ig 154..220 CDD:143165 17/81 (21%)
Ig_3 226..305 CDD:290638 18/85 (21%)
IG_like 233..319 CDD:214653 22/117 (19%)
Ig 341..404 CDD:299845
IG_like 431..503 CDD:214653
Ig 436..500 CDD:143165
fn3 511..596 CDD:278470
FN3 625..715 CDD:238020
PDZ-binding. {ECO:0000250} 1177..1179
dpr6NP_001287018.1 V-set 79..174 CDD:284989 20/97 (21%)
IG_like 80..175 CDD:214653 20/97 (21%)
IG_like 184..271 CDD:214653 18/87 (21%)
IGc2 191..262 CDD:197706 17/71 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.