DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: IGSF9 and tutl

Sequence 1:NP_001128522.1 Gene:IGSF9 HGNCID:18132 Length:1179 Species:Homo sapiens
Sequence 2:NP_001303307.1 Gene:tutl FlyBaseID:FBgn0010473 Length:1536 Species:Drosophila melanogaster

Alignment Length:1492 Identity:385/1493 (26%)
Similarity:586/1493 (39%) Gaps:421/1493 (28%)


Human     7 LAVLSLVISQGADGRGKPE-VVSVVGRAGESVVLGCDLLPPAGRPPLHVIEW----LRFGFLLPI 66
            |..|..::::.|.....|| .|.:....||.|:..|.:..|...|..:|::|    ...|..|||
  Fly   115 LVSLLALLAKNAQAHNIPEDAVHITAILGEGVIFNCHVEFPNDHPVPYVLQWDKKVSETGSDLPI 179

Human    67 FIQFGLYSPRIDPDYVGRV-RLQK-----GASLQIEGLRVEDQGWYECRVFFLD----QHIPEDD 121
            :|.:..|...|:..|.||| |:.:     .|||.:..:|..|||||||:|.||:    ||     
  Fly   180 YIWYESYPEHIEEGYKGRVSRVSQDSPFGSASLNLTNIRESDQGWYECKVVFLNRDPKQH----- 239

Human   122 FANGSWVHLTVNSPPQFQETPPAVLEVQELEPVTLRCVARGSPLPHVTWKLRGKDLGQGQGQVQV 186
             .||:|.||.|::||:|..||..::.|...:.:.|.|.|.|:|.|.:.|.   ||.........|
  Fly   240 -KNGTWFHLDVHAPPRFSVTPEDIIYVNLGDSIILNCQADGTPTPEILWY---KDANPVDPSPTV 300

Human   187 ---QNGT-LRIRRVERGSSGVYTCQASSTEGSATHATQLLVLGPPVIVVPPKNSTVNASQDVSLA 247
               .:|| |||..:.....|.|||.|.:.||..:|..::::.|..||:|||.|.|....:.|..:
  Fly   301 GIFNDGTELRISTIRHEDIGEYTCIARNGEGQVSHTARVIIAGGAVIMVPPTNQTKLEGEKVIFS 365

Human   248 CHAEAYPANLTYSWFQDNINVFHISRLQPRVRILVDGSLRLLATQPDDAGCYTCVPSNGLLHPPS 312
            |.|:|.|.|:|..|:::...|..::.|:.||.|..||||.:...:|||:|.|.|..:||:..|.|
  Fly   366 CEAKAMPGNVTVRWYREGSPVREVAALETRVTIRKDGSLIINPIKPDDSGQYLCEVTNGIGDPQS 430

Human   313 ASAYLTVLYPAQVTAMPPETPLPIGMPGVIRCPVRANPPLLFVSWTKDGKALQLDKFPGWSQGTE 377
            |||||:|.|||:||..|....||..:.||::|.::::|.|.:|:||||.:.|:..:.........
  Fly   431 ASAYLSVEYPAKVTFTPTVQYLPFRLAGVVQCYIKSSPQLQYVTWTKDKRLLEPYQMKDIVVMAN 495

Human   378 GSLIIALGNEDALGEYSCTPYNSLGTAGPSPVTRVLLKAPPAFIERPKEEYFQEVGRELLIPC-- 440
            |||:....||:..|:|:|||||:.||||.|.|..||::.||||...|:..|.::||..:.:.|  
  Fly   496 GSLLFTRVNEEHQGQYACTPYNAQGTAGASGVMDVLVRKPPAFTVEPETLYQRKVGDSVEMHCDA 560

Human   441 -SAQGDPPPVVSWTKVGRGLQGQAQVD--------SNSSLILRPLTKEAHGHWECSASNAVARVA 496
             .|:|...|.:.|.:    .:|:...:        |..::.:..|.:|..|:::|..||.||.:.
  Fly   561 LEAEGTERPTIKWQR----QEGEQLTESQRNRIKISGGNITIENLRREDFGYYQCVVSNEVATLM 621

Human   497 TSTNVYVLGTSPHVVTNVSVVALPKGANVSWEPGFDGG--YLQRFSVWYTPLAKRPDRMHHDWVS 559
            ..|.:.:.||.||...|::..|......:.|.||:.||  |.|.:::|:.....      :||.:
  Fly   622 AVTQLVIEGTQPHAPYNITGKATESSITLQWLPGYSGGSEYKQDYTIWFREAGV------NDWQT 680

Human   560 LAV-PVGAAHLLVPGLQPHTQYQFSVLAQNKLGSGPFSEIVLSAPEGLPTTPAAP---------- 613
            ::| |.|:..:.:.||...|.|:|.|:.:|.||.|..|:::  ....|...||||          
  Fly   681 ISVTPSGSTQVTINGLASGTTYEFQVVGRNVLGDGMMSKVM--TVRTLEDAPAAPRNVKAATQPP 743

Human   614 ----GLPPTEI---------------------PPPL-------SPPRGLVAVRTPRGVLLHWDPP 646
                .|.|.|.                     ||.|       .|||.:.......|.|:.|..|
  Fly   744 DSFFQLMPDEADLLAYFDIYFHTDSRGTLVYSPPKLRVKGPKPGPPRNVSVTEVSNGFLITWQSP 808

Human   647 ELVPKRLDGYVLEGRQGSQGWEVLDPA-VAGTETELLVPGLIKDVLYEFRLVAFAGSFVSDPSNT 710
            ......:..|.::.|..:| |:.|:.. :...||:.||..|:....|.||::|          |:
  Fly   809 LERAHIVKFYTIKYRTDAQ-WKTLNRGQIRPEETQYLVKNLVGGRTYYFRVLA----------NS 862

Human   711 ANVSTSGLEV---YPSRTQLPGLLPQPVLAGVVGGVCFLGVAVLVSILAGCLLNRRRAARRRRKR 772
            .....|..||   .|:|.:     .:.:.||||||:.|..||:::|:.|..:.|:    |:|||:
  Fly   863 EKSYESSDEVKFPVPARVK-----HKAITAGVVGGILFFIVAIILSVCAVKICNK----RKRRKQ 918

Human   773 LRQDPPLIFSPT-GKSAAPS-------ALGSGSPDSVAKLKLQGSPVPSLRQSL------LWGDP 823
            .::...:....| .::.|.:       :.||.|...|...|.:.:.:.||...|      :|...
  Fly   919 EKEFNMVACRITDARNIAANNHHLHNRSTGSISSGQVPLKKYKQTRISSLTAILIAILHWIWPPD 983

Human   824 AGT------PSPH-----PDPPSSRGPLPLEPICRGPDGRFVMG--------------------- 856
            ..|      .||:     .|.........:..|.|..|||||:.                     
  Fly   984 RCTNCHSIYSSPNLEDGDEDDGGGGRRRSVSRIQRSLDGRFVLDVEGVSKLGYSQQTLESGNVDV 1048

Human   857 ---------------------------------------PTVAAPQERS---------------- 866
                                                   |.||:..:.|                
  Fly  1049 VDGGLFERRNSNVSQKSSSDDGGFLSRRNFITARASWRRPLVASSSQLSLQSAADSARGFLQGLL 1113

Human   867 ---GREQAEP------------------------------------------------------R 874
               .::.|.|                                                      .
  Fly  1114 KIGAKQSAVPPNSQSYFDEAVSGARYQNVLRPYTSSNNLYGNADRSRPLHINTISGSLSQQQQLY 1178

Human   875 TPAQRLARSFDCS-------------SSSPSGAPQPLCIEDISPVAPPPAAPPSPLPGPGPLLQY 926
            ||: |::|.|..|             ||..||| .|....|:|.|.||.:|..|. .......:|
  Fly  1179 TPS-RISRIFSSSPQQLQPHHQQLLLSSGGSGA-YPTHFSDLSTVYPPNSAERSS-HNLSSRYRY 1240

Human   927 LS--LPFFREMN-------------VDGDWPPLEEPSPAAPPDYMDTRRC--PTSSFL------- 967
            .|  ||..|.:.             ::..:.||:.|||.:...|..::..  |.:.:.       
  Fly  1241 YSQELPSLRTIQEETRRQQQQKQHPLEDHFVPLQLPSPPSWRSYYQSQASYRPRTRWYPRHHSRL 1305

Human   968 ---RSPETPPVSPRESLPGAVVGAGATAEPPYTALADWTLRERLLPGLLPAAPRGSLTSQSSGRG 1029
               |..:...:||...|                   :..||..:.||.|.|:|..  .|.|||.|
  Fly  1306 FSNRQQQHEMLSPLPQL-------------------NLNLRNSMNPGGLEASPES--RSSSSGFG 1349

Human  1030 SASF-----------LRPPSTAPSAGGSYLSPAPGDTSSWASGPE----------RWPR------ 1067
            |.:.           |.||..||        |:|...|.:..|.:          .:||      
  Fly  1350 SKNTSNHPGSTSEWRLLPPYRAP--------PSPPKHSGYFGGQQAQGQTPHGSYSYPRATTPPY 1406

Human  1068 -REHVVTVSKRRNT----------------SVDENYEWDSEFP---GDMELLETLHLGLASSRLR 1112
             ..|.:.:..|.|.                |||.:||:|...|   ....|.|.|:|.:.:   .
  Fly  1407 TMAHWLEMISRLNAATDSNLPKAPCPVDVGSVDGHYEFDPATPTPSASSMLREDLNLHIDT---H 1468

Human  1113 PEAEPELGVKTPEEGCLLNT---------------AHV---TGPEARCAALREEFLAFRRRR 1156
            |.....||   |..|.||::               ||:   ...|.|..|:||||.|:|:|:
  Fly  1469 PYHHHTLG---PLSGSLLHSHAPYGGGARKQRSLPAHLPRYDNVEVRLQAMREEFYAYRKRQ 1527

Known Domains:


GeneSequenceDomainRegion External IDIdentity
IGSF9NP_001128522.1 Ig 24..132 CDD:299845 44/123 (36%)
IG_like 28..110 CDD:214653 31/92 (34%)
I-set 136..223 CDD:254352 28/91 (31%)
Ig 154..220 CDD:143165 23/70 (33%)
Ig_3 226..305 CDD:290638 30/79 (38%)
IG_like 233..319 CDD:214653 35/86 (41%)
Ig 341..404 CDD:299845 24/63 (38%)
IG_like 431..503 CDD:214653 18/83 (22%)
Ig 436..500 CDD:143165 16/75 (21%)
fn3 511..596 CDD:278470 25/88 (28%)
FN3 625..715 CDD:238020 22/91 (24%)
PDZ-binding. {ECO:0000250} 1177..1179
tutlNP_001303307.1 V-set 137..250 CDD:284989 42/119 (35%)
IG_like 137..229 CDD:214653 31/92 (34%)
I-set 253..341 CDD:254352 28/91 (31%)
IGc2 268..331 CDD:197706 21/66 (32%)
I-set 346..437 CDD:254352 39/91 (43%)
Ig 349..437 CDD:299845 37/88 (42%)
Ig 459..530 CDD:299845 28/71 (39%)
IG_like 549..628 CDD:214653 18/83 (22%)
IGc2 551..617 CDD:197706 14/70 (20%)
FN3 633..725 CDD:238020 28/100 (28%)
FN3 786..874 CDD:238020 25/99 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 431 1.000 Inparanoid score I1699
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D151368at33208
OrthoFinder 1 1.000 FOG0001378
OrthoInspector 1 1.000 T609488
orthoMCL 1 0.900 OOG5_132103
Panther 1 1.100 O PTHR10075
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4797
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1211.870

Return to query results.
Submit another query.