DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: IGSF9 and DIP-gamma

Sequence 1:NP_001128522.1 Gene:IGSF9 HGNCID:18132 Length:1179 Species:Homo sapiens
Sequence 2:NP_651649.1 Gene:DIP-gamma FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster

Alignment Length:362 Identity:92/363 (25%)
Similarity:134/363 (37%) Gaps:105/363 (29%)


Human    24 PEVVSVVGR----AGESVVLGCDLLPPAGRPPLHVIEWLRFGFLLPIFIQFGLYSPRIDPDYVGR 84
            ||.:..:..    ||...:|.|. :...|:   :.:.|||......:.:|             ||
  Fly    39 PEFIGFINNVTYPAGREAILACS-VRNLGK---NKVGWLRASDQTVLALQ-------------GR 86

Human    85 VRLQKGA-----------SLQIEGLRVEDQGWYEC---------RVFFLDQHIPEDDFANGSWVH 129
            |......           .|:|..||..|:|.|.|         :|..:|..:|.|         
  Fly    87 VVTHNARISVMHQDMHTWKLKISKLRESDRGCYMCQINTSPMKKQVGCIDVQVPPD--------- 142

Human   130 LTVNSPPQFQETPPAVLEVQELEPVTLRCVARGSPLPHVTWK-------LRGKDLGQGQGQVQVQ 187
             .:|      |...|.|.|||.|..||.|.|.|:|.|.|||:       |..|...:...:|:..
  Fly   143 -IIN------EESSADLAVQEGEDATLTCKATGNPQPRVTWRREDGEMILIRKPGSRELMKVESY 200

Human   188 NG-TLRIRRVERGSSGVYTCQASS-TEGSATHATQLLVLGPPVIVVPPKNSTVNASQDVSLACHA 250
            || :||:.|:||...|.|.|.||: ...:.:....|.|...|::..|.:........||.|.|..
  Fly   201 NGSSLRLLRLERRQMGAYLCIASNDVPPAVSKRVSLSVQFAPMVRAPSQLLGTPLGSDVQLECQV 265

Human   251 EAYPANLTYSWFQD--------NINVFHISRLQPRVRILVDG-------------SLRLLATQ-- 292
            ||.|:.::| |.:.        :::...:....|...:|:||             .:.||..:  
  Fly   266 EASPSPVSY-WLKGARTSNGFASVSTASLESGSPGPEMLLDGPKYGITERRDGYRGVMLLVVRSF 329

Human   293 -PDDAGCYTCVPSNGL-------------LHPPSASA 315
             |.|.|.|.||.:|.|             || |.|||
  Fly   330 SPSDVGTYHCVSTNSLGRAEGTLRLYEIKLH-PGASA 365

Known Domains:


GeneSequenceDomainRegion External IDIdentity
IGSF9NP_001128522.1 Ig 24..132 CDD:299845 26/132 (20%)
IG_like 28..110 CDD:214653 20/106 (19%)
I-set 136..223 CDD:254352 33/96 (34%)
Ig 154..220 CDD:143165 25/75 (33%)
Ig_3 226..305 CDD:290638 23/103 (22%)
IG_like 233..319 CDD:214653 29/121 (24%)
Ig 341..404 CDD:299845
IG_like 431..503 CDD:214653
Ig 436..500 CDD:143165
fn3 511..596 CDD:278470
FN3 625..715 CDD:238020
PDZ-binding. {ECO:0000250} 1177..1179
DIP-gammaNP_651649.1 IG_like 47..139 CDD:214653 22/109 (20%)
Ig 47..129 CDD:299845 20/99 (20%)
Ig 140..238 CDD:299845 36/114 (32%)
IG_like 247..355 CDD:214653 24/109 (22%)
Ig 256..351 CDD:299845 23/96 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.