DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: IGSF9 and Dscam3

Sequence 1:NP_001128522.1 Gene:IGSF9 HGNCID:18132 Length:1179 Species:Homo sapiens
Sequence 2:NP_996226.2 Gene:Dscam3 FlyBaseID:FBgn0261046 Length:2087 Species:Drosophila melanogaster

Alignment Length:1350 Identity:263/1350 (19%)
Similarity:428/1350 (32%) Gaps:404/1350 (30%)


Human    24 PEVVSVVGRAGESVVLGCDLLPPAGRPPLHVIEWLRFGFLLPIFIQFGLYSPRIDPDYVGRVRLQ 88
            |:|..|  .:|.:....|.....|    :..|:||..|  .|:.....|.:.|      ..:|..
  Fly   347 PQVQIV--NSGGTANFNCTTTGSA----IDAIDWLHNG--KPLQANNALTTGR------DNIRFL 397

Human    89 KGASLQIEGLRVEDQGWYECRVFFLDQHIPEDDFANGSWVHLTVNSPPQFQETPPAVLEV---QE 150
            ..:||.::.:...|:|.|:|.|        |:..|:..     ..:..:..:|.|.::..   |.
  Fly   398 SKSSLLVQNVGRRDRGVYQCLV--------ENQRASAQ-----AMAELKLGDTVPELIYTFIEQN 449

Human   151 LEP---VTLRCVARGSPLPHVTWKLRGKDLGQ-------GQGQVQVQNGT----LRIRRVERGSS 201
            :.|   ::|:|.|.|||.|...|.|..:.:..       ..||....:|.    |.|..|.....
  Fly   450 VRPGPLISLKCSASGSPPPQFAWLLDSQPIMDVSLHHRFAIGQFVDMSGDVISHLNISHVRPDDG 514

Human   202 GVYTCQASSTEGSATHATQLLVLGPPVI-VVPPKNSTVNASQDVSLACHAEAYPA---------- 255
            |:|.|.||::.||..|:.:|.|.|||.: .:.|..:.  |.:|:.:.|....||.          
  Fly   515 GLYKCVASNSMGSVQHSARLNVYGPPYVRAIGPIKAV--AGEDIIVHCPFAGYPVEQIRWEKAHQ 577

Human   256 NLTYSWFQDNINVFHISRLQPRVRILVDGSLRLLATQPD-DAGCYTCVPSNGLLHPPSASAYLTV 319
            .||.|      |.:.::      .:...|.|.:...:|. |.|.|||:..:...........|.|
  Fly   578 ELTTS------NHYELA------SVADGGQLVIKNVEPGRDQGIYTCIVRSRAGEEARRDMQLNV 630

Human   320 LYPAQVTAMPPETPLPIGMPGVIRCPVRANPPLLFVSWTKD------------------------ 360
            ..|..:........|..|....|.|.|.:....::.||.||                        
  Fly   631 NSPPVIEPFKFPKNLQEGGRAQITCAVSSGDMPIYFSWKKDDSSIPSSLQITEKKEEFYSLLVFK 695

Human   361 -------GK----------------ALQLDKFPGW------------------------------ 372
                   ||                .||:...|.|                              
  Fly   696 DISARHSGKYTCYASNAAAKVNYTAELQVRVAPRWRYEPMDTAIMLGNTISINCEAEGYPIPTIT 760

Human   373 ---SQG-----------TEGSLIIALGNEDALGEYSCTPYNSLGTAGPSPVTRVLLKAPPAFIER 423
               .||           ...||::.|..::..|.|.|...|.:| ||.....|:.:..|..| |:
  Fly   761 WFKGQGKGSKDFKPLSMRNHSLLLNLATDNDEGYYMCQATNEIG-AGLKKTIRINVNEPARF-EQ 823

Human   424 PKEEYFQEVGRELLIPCSAQGDPPPVVSWTKVGRGLQGQAQVDSN----------------SSLI 472
            ............:.:.|.|:||.|..:.||      |...::|.|                |.|.
  Fly   824 SARNISSRRNDPVTLDCHAKGDEPITIGWT------QNNGRIDLNNFRFSIAEMKTEKGVDSQLT 882

Human   473 LRPLTKEAHGHWECSASNAVARVATSTNVYVLGTSPHVVTNVSVVAL-PKGANVSWEPGFDG--- 533
            :....:...|.:.|.|.|...| |.......:...|...:::.:..: .:...:||...|||   
  Fly   883 IGHSDRHDSGVYRCIAENPYGR-AEQIIFLAVQERPDTPSHLEIFEVGSRTVKLSWRRPFDGNSP 946

Human   534 --GYLQRFSVWYTPLAKRPDRMH-------HDW----VSLAVP---VGAAH-------LLVPGLQ 575
              .||.::.      |.:..:.|       .||    :::::|   :..::       .:|.||.
  Fly   947 VLSYLVQYQ------ALKYLQSHGSLAAAGGDWNGHVINVSLPSTSISRSYDSDLRESAIVAGLT 1005

Human   576 PHTQYQFSVLAQNKLGSGPFSE-IVLSAPEGLPTTPAAPGLPPTEIPPPLSPPRGLVAVRTPRGV 639
            |.|.:...:.|.|::....::| |||...|..||.               :|....|.......:
  Fly  1006 PATTFLIRMQAINEIERSAYTEAIVLKTQEEAPTE---------------APSNVQVQTGGESEL 1055

Human   640 LLHWD--PPELVPKRLDGYVL---EGRQGSQGWEVLDPAVAGT------ETELLVPGLIKDVLYE 693
            ::.|.  |.|.....|.||.:   |.:|......|::.::..|      .|:..:.||.|...|.
  Fly  1056 IVTWQIPPRESWNGELIGYTVNCSEEKQNINFISVVNSSLKSTIVSGWATTKATLRGLRKYSRYA 1120

Human   694 FRLVAFAGSFVSDPSNTANVSTS--GL-EVYPSRTQLPGLLPQ--------PVL---AGVVGGVC 744
            ..:.|. .||.|.|.:.|...|:  |: |..|.......|..|        |.|   .|::.|..
  Fly  1121 VTIRAM-NSFGSGPWSAAIFGTTAEGVPEAAPQNVNCTALSSQSLKISWLEPPLQFHGGIIQGYK 1184

Human   745 FLGVAVLVSILAGCLLNRRRAA----------RRRRKRLRQDPPLIFSPTGKSAAPSAL----GS 795
            .|...::..|.....|..:|.:          :.....:|   .|.::.||...|...|    ..
  Fly  1185 ILYRPIVHQIDFPAKLEIKRTSNLETYLHTLHKASNYSIR---VLAYTATGDGLASHPLFCQTDD 1246

Human   796 GSPDSVAKLKLQGSPVPSLRQSLLWGDPAGTPSPHPDPPSSRGPLPLEPICRGPDGRFVMGPTVA 860
            ..||:.|.:|.......|:..|.|            .|.:..|.:....:.....||.....|..
  Fly  1247 DVPDAPAAIKAAALTADSILISWL------------TPKNRNGIISHYTVYSREAGRKGQAKTHM 1299

Human   861 APQERSGREQA-EPRTPAQRLARSFDCSSSSPSGAPQPLCIEDISPVAPPPAAPPS------PLP 918
            ...:.:|.... |.|:.|:.....|..|:|:..|..:|..:...:.....||...|      ...
  Fly  1300 VRVDENGYPVTFESRSLAENQMYEFWVSASTSVGEGEPTSVIAQATNTRAPARIASFGQVVRKAV 1364

Human   919 GPGPLLQYLSLPFFREMNVDGDWPPLEEPSPAAPPDYMDTRRCPTSSFLRSPETPPVSPRESLPG 983
            |.|.:|:.|:               :..|:|.|   ...||..|                     
  Fly  1365 GTGLVLECLA---------------VGNPTPRA---RWLTRDRP--------------------- 1390

Human   984 AVVGAGATAEPPYTALADWTLRERLLPGLLPAAPRGSLTSQSS---GRGSASF----LRPPST-- 1039
                  .|..|.|....:..|:...:.|.|    .|:.|..::   |.....:    ::|||.  
  Fly  1391 ------VTFSPFYEVTNEGNLKIHRVEGSL----SGNYTCTANNLFGSDEIQYQVIAMKPPSAPQ 1445

Human  1040 ----------------APSAGGSYLSPAPGDTSSWASGPERWPRRE------------------H 1070
                            ||..||   :|..|.|.|:.:..|.|...|                  :
  Fly  1446 IIVQYASADSIRVSWDAPDDGG---APLQGYTISYHTAGESWSITELLPENNAFTISGLKCGNQY 1507

Human  1071 VVTVSKRR----NTSVDENYEWD----SEFPGDMELLET----LHLGLAS 1108
            ::.:|...    ..:.:|...|.    |:.|...||:.|    ::|.|:|
  Fly  1508 IIKMSAHNMVGSGVASEEINVWTKGKASQAPNANELIATNATCVNLKLSS 1557

Known Domains:


GeneSequenceDomainRegion External IDIdentity
IGSF9NP_001128522.1 Ig 24..132 CDD:299845 23/108 (21%)
IG_like 28..110 CDD:214653 18/82 (22%)
I-set 136..223 CDD:254352 28/104 (27%)
Ig 154..220 CDD:143165 23/77 (30%)
Ig_3 226..305 CDD:290638 20/91 (22%)
IG_like 233..319 CDD:214653 19/97 (20%)
Ig 341..404 CDD:299845 23/154 (15%)
IG_like 431..503 CDD:214653 18/88 (20%)
Ig 436..500 CDD:143165 18/80 (23%)
fn3 511..596 CDD:278470 19/112 (17%)
FN3 625..715 CDD:238020 23/101 (23%)
PDZ-binding. {ECO:0000250} 1177..1179
Dscam3NP_996226.2 IG 56..133 CDD:214652
Ig 56..125 CDD:143165
I-set 246..337 CDD:254352
Ig 264..334 CDD:143165
I-set 345..433 CDD:254352 23/113 (20%)
Ig 358..431 CDD:143165 19/98 (19%)
Ig 456..533 CDD:143165 23/77 (30%)
IGc2 553..619 CDD:197706 16/78 (21%)
I-set 634..724 CDD:254352 13/90 (14%)
ig 645..712 CDD:278476 11/67 (16%)
IG_like 734..815 CDD:214653 13/82 (16%)
Ig 745..815 CDD:299845 13/71 (18%)
I-set 820..913 CDD:254352 20/101 (20%)
Ig 838..920 CDD:299845 19/89 (21%)
FN3 917..1033 CDD:238020 24/122 (20%)
FN3 1040..1142 CDD:238020 24/118 (20%)
fn3 1150..1237 CDD:278470 16/90 (18%)
FN3 1263..1345 CDD:238020 17/94 (18%)
Ig 1350..1436 CDD:299845 22/135 (16%)
IG_like 1358..1436 CDD:214653 19/127 (15%)
FN3 1441..1530 CDD:238020 16/92 (17%)
FN3 1542..1620 CDD:238020 6/16 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.