DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: IGSF9 and dpr15

Sequence 1:NP_001128522.1 Gene:IGSF9 HGNCID:18132 Length:1179 Species:Homo sapiens
Sequence 2:NP_001287299.1 Gene:dpr15 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster

Alignment Length:530 Identity:113/531 (21%)
Similarity:185/531 (35%) Gaps:153/531 (29%)


Human    28 SVVGRAGESVVLGCDLLPPAGRPPLHVIEWLRF--GFLLPI----FI---QF-GLYSPRIDPDYV 82
            :::.:||....|.|::.....:|    |.|||.  |.:|.:    ||   :| .::||  :|:  
  Fly   198 TIISQAGTHAYLPCNVKQLVKKP----ISWLRMRDGHILTVDQTTFIADQRFQSVFSP--NPE-- 254

Human    83 GRVRLQKGASLQIEGLRVEDQGWYECRVFFLDQHIPEDDFANGSWVHLTVNSPPQFQETPPAVLE 147
                   ..||||:.::::|:|.|||:|        ..:....:.|||.: ..|:.:....:...
  Fly   255 -------RWSLQIKYVQLKDEGTYECQV--------STEPKASAIVHLRI-V
EPKTELIGESTRH 303

Human   148 VQELEPVTLRCV---ARGSPLPHVTWKLRGKDLGQGQGQVQVQN---GTLRIRRV----ERGSSG 202
            |:....|.|||:   |...|| .:.|       ...|.|:.:.|   ....|.|:    |..::.
  Fly   304 VKAGSQVKLRCIISQALEPPL-FINW-------FYNQKQIYLHNRRGWRTEIERIDLPAEVPTTS 360

Human   203 VYTCQASSTEGSATHATQLLVLGPPVIVVPPKNSTVNASQDVSLACHAEAYPANLTYSWFQDNIN 267
            ..|...::|..:.|..|......|        ::|...|.:.:.:.........:|.|:..|.|:
  Fly   361 TTTTTTTTTASTTTTTTSTTPATP--------STTATGSTEGATSSETLNGLVTITRSYILDAIS 417

Human   268 VFHISRL--QPRVRILVDGSLRLLATQPD--------------------------DAGCYTCVPS 304
            ...:|.|  ...|.:..:.|...|.|:.:                          .||..|....
  Fly   418 QNDVSELGAAAGVAVATETSTAQLLTEVEATSSTSGTSTGAGLLASTSAAYAAGAAAGITTAATG 482

Human   305 NGLLHPPSASAYLTVL--YPAQVTAMPPETPLPIGMPGVIRCPVRANPPLLFVSWTKDGKALQLD 367
            :......:.||:||.:  ..|...|....|.||..                  |:.|        
  Fly   483 DSAATAATTSAWLTTMDAEAATTAATTTTTMLPSS------------------SFIK-------- 521

Human   368 KFPGWSQGTEGSLII-ALGNEDALGEYSCTPYNSLGTAGPSPVTRVLLKAPPAFIERPKEEYFQE 431
                  |.|..|||| |:...|: |.|:|:|.||    .|..:...:|..          ||   
  Fly   522 ------QITTASLIIPAVVKLDS-GNYTCSPSNS----APRTIVLHVLNG----------EY--- 562

Human   432 VGRELLIPCSAQGDPPPVVSWTKVGRGLQGQAQVDSNSSLI-LRPLTKEAHGHWECSASNAVARV 495
                     ||.......|||:.: .|..|.....:.|:|: |..:.|.|.....|. .||.::.
  Fly   563 ---------SASAIKSGSVSWSAL-IGCHGYLHWRNVSTLLTLLWIIKFALARDICQ-PNATSKA 616

Human   496 ATSTNVYVLG 505
            .|.|::...|
  Fly   617 TTRTSLLRAG 626

Known Domains:


GeneSequenceDomainRegion External IDIdentity
IGSF9NP_001128522.1 Ig 24..132 CDD:299845 30/114 (26%)
IG_like 28..110 CDD:214653 26/92 (28%)
I-set 136..223 CDD:254352 20/97 (21%)
Ig 154..220 CDD:143165 18/76 (24%)
Ig_3 226..305 CDD:290638 16/107 (15%)
IG_like 233..319 CDD:214653 19/114 (17%)
Ig 341..404 CDD:299845 16/64 (25%)
IG_like 431..503 CDD:214653 17/73 (23%)
Ig 436..500 CDD:143165 17/65 (26%)
fn3 511..596 CDD:278470
FN3 625..715 CDD:238020
PDZ-binding. {ECO:0000250} 1177..1179
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 30/114 (26%)
V-set 204..290 CDD:284989 29/110 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.