DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: IGSF9 and dpr5

Sequence 1:NP_001128522.1 Gene:IGSF9 HGNCID:18132 Length:1179 Species:Homo sapiens
Sequence 2:NP_650080.3 Gene:dpr5 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster

Alignment Length:163 Identity:44/164 (27%)
Similarity:74/164 (45%) Gaps:16/164 (10%)


Human   191 LRIRRVERGSSGVYTCQASSTEGSATHATQLLVLGPPVIVVPPKNSTVNASQDVSLACHAEAYPA 255
            |:|..|::..:|||.||. |||...:.|.:|:|:.....::..:...:.:..|::|.|.|...|.
  Fly   159 LKIVSVQQRDAGVYECQV-STEPKISLAYKLVVV
TSKAQILANRELFIQSGSDINLTCIAPQAPG 222

Human   256 NLTYS-WFQDNINVFHISRLQPRV---RILVDGSLRLLATQPDDAGCYTCVPSNGLLHPPSASAY 316
            ..|:. |.:|...|...:|...||   :.:...:|.:...|..|:|.|||...|.    .|.|.:
  Fly   223 PYTHMLWHKDTELVSDSARGGIRVESEQQMKTSNLVISRVQHTDSGNYTCSADNS----NSDSVF 283

Human   317 LTVLYPAQVTAMPPE-------TPLPIGMPGVI 342
            :.::...|..||..|       .|||:.:..|:
  Fly   284 VHIIKSEQHAAMQHELGSRLLLPPLPLLLLAVL 316

Known Domains:


GeneSequenceDomainRegion External IDIdentity
IGSF9NP_001128522.1 Ig 24..132 CDD:299845
IG_like 28..110 CDD:214653
I-set 136..223 CDD:254352 13/32 (41%)
Ig 154..220 CDD:143165 12/29 (41%)
Ig_3 226..305 CDD:290638 19/83 (23%)
IG_like 233..319 CDD:214653 22/90 (24%)
Ig 341..404 CDD:299845 1/3 (33%)
IG_like 431..503 CDD:214653
Ig 436..500 CDD:143165
fn3 511..596 CDD:278470
FN3 625..715 CDD:238020
PDZ-binding. {ECO:0000250} 1177..1179
dpr5NP_650080.3 V-set 95..191 CDD:284989 14/33 (42%)
IG_like 98..179 CDD:214653 10/21 (48%)
IG_like 206..278 CDD:214653 20/76 (26%)
Ig 211..278 CDD:143165 19/71 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.