DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: IGSF9 and Ama

Sequence 1:NP_001128522.1 Gene:IGSF9 HGNCID:18132 Length:1179 Species:Homo sapiens
Sequence 2:NP_731114.2 Gene:Ama FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster

Alignment Length:225 Identity:67/226 (30%)
Similarity:99/226 (44%) Gaps:19/226 (8%)


Human   190 TLRIRRVERGSSGVYTCQ--ASSTEGSATHATQLLVLGPPVIVV-PPKNSTVNASQDVSLACHAE 251
            |.||:.:|....|.|.||  .|:|| ..|....|.:..||||.. .||::.|...|::.|.|||.
  Fly   109 TFRIQNIEVSDMGPYECQVLVSATE-KVTKKLSLQI
KTPPVIAENTPKSTLVTEGQNLELTCHAN 172

Human   252 AYPANLTYSWFQDNINVFHISRLQPRVRILVDGSLRLLATQPDDAGCYTCVPSNGLLHPPSASAY 316
            .:| ..|.||.::     |.:.:.....:|.:.:||:.:....|.|.|.|:..||...|......
  Fly   173 GFP-KPTISWARE-----HNAVMPAGGHLLAEPTLRIRSVHRMDRGGYYCIAQNGEGQPDKRLIR 231

Human   317 LTVLYPAQVTAMPPETPLPIGMPGVIRCPVRANPPLLFVSWTKDGKALQLDKF-----PGWSQGT 376
            :.|.:..|:....|:....:.....:.|.|:..|....| |.|:|..||..:.     ...|.||
  Fly   232 VEV
EFRPQIAVQRPKIAQMVSHSAELECSVQGYPAPTVV-WHKNGVPLQSSRHHEVANTASSSGT 295

Human   377 EGSL--IIALGNEDALGEYSCTPYNSLGTA 404
            ..|:  |.::|.|| .|:|.|...|.||.|
  Fly   296 TTSVLRIDSVGEED-FGDYYCNATNKLGHA 324

Known Domains:


GeneSequenceDomainRegion External IDIdentity
IGSF9NP_001128522.1 Ig 24..132 CDD:299845
IG_like 28..110 CDD:214653
I-set 136..223 CDD:254352 13/35 (37%)
Ig 154..220 CDD:143165 12/32 (38%)
Ig_3 226..305 CDD:290638 24/80 (30%)
IG_like 233..319 CDD:214653 23/86 (27%)
Ig 341..404 CDD:299845 23/70 (33%)
IG_like 431..503 CDD:214653
Ig 436..500 CDD:143165
fn3 511..596 CDD:278470
FN3 625..715 CDD:238020
PDZ-binding. {ECO:0000250} 1177..1179
AmaNP_731114.2 I-set 33..143 CDD:254352 13/35 (37%)
Ig 37..127 CDD:299845 8/18 (44%)
IG_like 154..234 CDD:214653 23/86 (27%)
IGc2 161..223 CDD:197706 19/68 (28%)
I-set 254..330 CDD:254352 24/74 (32%)
IGc2 254..322 CDD:197706 22/70 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.