DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: IGSF9 and dpr11

Sequence 1:NP_001128522.1 Gene:IGSF9 HGNCID:18132 Length:1179 Species:Homo sapiens
Sequence 2:NP_001262320.1 Gene:dpr11 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster

Alignment Length:263 Identity:76/264 (29%)
Similarity:94/264 (36%) Gaps:46/264 (17%)


Human   174 GKDLGQGQGQVQVQNGTLRIRRVERGSSGVYT-----CQASS--TEGSATHATQLLVLGPPVIVV 231
            |....:|.|.......:..|...|.|.....|     .|.||  .|.||..||..|| .|.:...
  Fly    59 GAGTSEGAGTSSASAASTAISSDESGDPSSATAFSSLAQVSSLLPEASALSATSGLV-EPYLDGY 122

Human   232 PPKNSTVNASQDVSLACHAEAYPANLTYSWFQDNINVFHISRLQPRVRILVDGSLRLLA-TQPD- 294
            ...|.|........|.|..:.. .|.:.||.:  :...||..:...|.|   ...|.|| .||| 
  Fly   123 ATSNVTTQIGTHAYLPCRVKQL-GNKSVSWIR--LRDGHILTVDRAVFI---ADQRFLAIKQPDK 181

Human   295 ------------DAGCYTCVPSNGLLHPP-SASAYLTVLYPAQVTAMPPETPLPIGMPGVIRCPV 346
                        |||.|.|..|.   .|. ||...|.|:.|.......|:..:..|...|:||.|
  Fly   182 YWTLQIKYVQARDAGSYECQVST---EPKVSARVQLQVVVPRTEILGEPDRYVKAGSNVVLRCIV 243

Human   347 R-ANPPLLFVSWTKDGKAL---------QLD----KFPGWSQGTEGSLIIALGNEDALGEYSCTP 397
            | |..|..|:.|....:.|         |||    :..|..|.|.|||||....:...|.|:|:|
  Fly   244 RGALEPPTFIMWYHGAEQLAADSRRHRTQLDPNLPEASGEGQSTIGSLIIESAKKRDTGNYTCSP 308

Human   398 YNS 400
            .||
  Fly   309 SNS 311

Known Domains:


GeneSequenceDomainRegion External IDIdentity
IGSF9NP_001128522.1 Ig 24..132 CDD:299845
IG_like 28..110 CDD:214653
I-set 136..223 CDD:254352 16/56 (29%)
Ig 154..220 CDD:143165 15/53 (28%)
Ig_3 226..305 CDD:290638 24/93 (26%)
IG_like 233..319 CDD:214653 27/101 (27%)
Ig 341..404 CDD:299845 27/75 (36%)
IG_like 431..503 CDD:214653
Ig 436..500 CDD:143165
fn3 511..596 CDD:278470
FN3 625..715 CDD:238020
PDZ-binding. {ECO:0000250} 1177..1179
dpr11NP_001262320.1 I-set 125..216 CDD:254352 27/100 (27%)
Ig 127..217 CDD:299845 27/99 (27%)
IG_like 227..320 CDD:214653 29/86 (34%)
IGc2 234..311 CDD:197706 27/77 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.