DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: IGSF9 and CG7166

Sequence 1:NP_001128522.1 Gene:IGSF9 HGNCID:18132 Length:1179 Species:Homo sapiens
Sequence 2:NP_001262181.1 Gene:CG7166 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster

Alignment Length:341 Identity:85/342 (25%)
Similarity:134/342 (39%) Gaps:82/342 (24%)


Human     3 WCLGLAVLSLVISQGADGRGKPEVVSVVGRAGESVVLGCDLLPPAGRPPLHVIEWLRFGFLLPIF 67
            |.|.|.:.|..:|                      ::|...:.|...||....::|..|.|..:.
  Fly     9 WTLVLYLFSFSLS----------------------LIGGSFILPENDPPTTAPKFLSRGHLYKVI 51

Human    68 IQFGLYSP-------------------------RIDPDYVGRVRLQKGASLQIEGLRVEDQGWYE 107
            :...:..|                         :|..|.  |.::....:|||.|::.:|.|.|.
  Fly    52 VGETIELPCKVQNLGSFVLLWRKGSSVLTAGHLKITRDQ--RFKIVGDYNLQINGVKTQDAGDYI 114

Human   108 CRVFFLDQHIPEDDFANGSWVH-LTVNSPPQFQETP-PAVLEVQELEPVTLRCVARGSPLPHVTW 170
            |::         .|..|...|| :.:..||..:..| ...:..::...|||.|.|.|:|:|.:.|
  Fly   115 CQL---------GDQENRDQVHTVEILVPPTLRALPHNGQVTARKGSTVTLECKASGNPVPTIFW 170

Human   171 KLRGKDLGQGQGQVQVQNGTLRIRRVERGSSGVYTCQA-SSTEGSATHATQLLVLGPPVIVVPPK 234
              ..||:..|...:. .:.||.:..|:|..:|.|.|.| :..:...:...||.:|.||.|.|  :
  Fly   171 --FKKDVFSGPTHLS-DSSTLILENVDRHHAGTYQCSADNGVKDRVSMDIQLTILSPPEITV--E 230

Human   235 NSTVNASQ--DVSLAC--HAEAYPANLTYSWFQDNINVFHISR--LQPRVRILVDG--SLRLLAT 291
            .|.|:||:  ||.|.|  |.:   .|....|:|::..:....|  :.||     |.  ||.:...
  Fly   231 KSWVHASEGYDVELVCIVHGD---VNSEMLWYQNSFLLDATDRRSMYPR-----DDRYSLIIRNF 287

Human   292 QPDDAGCYTCVPSNGL 307
            ||.|.|.|:||..|.|
  Fly   288 QPTDFGNYSCVADNAL 303

Known Domains:


GeneSequenceDomainRegion External IDIdentity
IGSF9NP_001128522.1 Ig 24..132 CDD:299845 23/134 (17%)
IG_like 28..110 CDD:214653 19/107 (18%)
I-set 136..223 CDD:254352 24/89 (27%)
Ig 154..220 CDD:143165 20/67 (30%)
Ig_3 226..305 CDD:290638 29/87 (33%)
IG_like 233..319 CDD:214653 27/84 (32%)
Ig 341..404 CDD:299845
IG_like 431..503 CDD:214653
Ig 436..500 CDD:143165
fn3 511..596 CDD:278470
FN3 625..715 CDD:238020
PDZ-binding. {ECO:0000250} 1177..1179
CG7166NP_001262181.1 IG_like 50..133 CDD:214653 16/94 (17%)
Ig 56..116 CDD:143165 12/62 (19%)
IG_like 144..221 CDD:214653 22/80 (28%)
IGc2 151..209 CDD:197706 20/61 (33%)
IG_like 232..313 CDD:214653 27/81 (33%)
Ig 242..311 CDD:143165 22/71 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.