DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: IGSF9 and dpr10

Sequence 1:NP_001128522.1 Gene:IGSF9 HGNCID:18132 Length:1179 Species:Homo sapiens
Sequence 2:NP_729591.1 Gene:dpr10 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster

Alignment Length:352 Identity:70/353 (20%)
Similarity:111/353 (31%) Gaps:122/353 (35%)


Human    28 SVVGRAGESVVLGCDLLPPAGRPPLHVIEWLRFGFLLPIFIQFGLYSPRIDPDYVGRVRLQKGA- 91
            ::....|:|..|||.:.....:    .:.|:|...|  ..:..|.|:      |....|.|... 
  Fly    62 NITSLVGKSAYLGCRVKHLGNK----TVAWIRHRDL--HILTVGTYT------YTTDQRFQTSYH 114

Human    92 ------SLQIEGLRVEDQGWYECRVF-----------------------FLDQHIPEDDF----- 122
                  :|||:..:..|.|.|||::.                       .:.|:..:|.|     
  Fly   115 RDIDEWTLQIKWAQQRDAGVYECQISTQPVRSYSVNLNIVDLIDAETSDIMQQYYNDDAFYIAEN 179

Human   123 -----ANGSWVHLTVNSPPQFQETPPAV------LEVQELEPVTLRCVARGSPLP--HVTWKLRG 174
                 :|..:..:.  .|.|....|.|.      |.|.:...:.|.|:.:.||.|  |:.|..:.
  Fly   180 RVYQSSNDEFAGMF--GPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFWYHQD 242

Human   175 KDLGQGQGQVQVQNGTLRIRRVERGS--------------SGVYTCQASSTEGSA--THATQLLV 223
            |.|.:     :...|.|:.:.::...              ||.|:|..|:||.::  .|..|   
  Fly   243 KVLSE-----ETSGGRLKFKTIKSEETKSILLIYDADLLHSGKYSCYPSNTEIASIRVHVLQ--- 299

Human   224 LGPPVIVVPPKNSTVNASQDVSLACHAEAYPANLTYSWFQDNINVFHISRLQPRVR--------- 279
             |..    |....|..|...|:|||            |      ..|..:....||         
  Fly   300 -GER----PEAMQTNAAPAAVALAC------------W------SCHFGQATQAVRVISTMVAAL 341

Human   280 ILVDGSLRLLATQPDDAGCYTCVPSNG 306
            :|::....||.......||    |..|
  Fly   342 VLLEACSSLLLQSGGGGGC----PGGG 364

Known Domains:


GeneSequenceDomainRegion External IDIdentity
IGSF9NP_001128522.1 Ig 24..132 CDD:299845 25/144 (17%)
IG_like 28..110 CDD:214653 21/89 (24%)
I-set 136..223 CDD:254352 25/111 (23%)
Ig 154..220 CDD:143165 19/84 (23%)
Ig_3 226..305 CDD:290638 17/88 (19%)
IG_like 233..319 CDD:214653 17/84 (20%)
Ig 341..404 CDD:299845
IG_like 431..503 CDD:214653
Ig 436..500 CDD:143165
fn3 511..596 CDD:278470
FN3 625..715 CDD:238020
PDZ-binding. {ECO:0000250} 1177..1179
dpr10NP_729591.1 Ig 63..143 CDD:299845 21/92 (23%)
IG_like 210..297 CDD:214653 21/92 (23%)
IGc2 217..287 CDD:197706 16/75 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.