Sequence 1: | NP_001128522.1 | Gene: | IGSF9 / 57549 | HGNCID: | 18132 | Length: | 1179 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001033956.2 | Gene: | dpr13 / 3885598 | FlyBaseID: | FBgn0034286 | Length: | 419 | Species: | Drosophila melanogaster |
Alignment Length: | 206 | Identity: | 50/206 - (24%) |
---|---|---|---|
Similarity: | 81/206 - (39%) | Gaps: | 57/206 - (27%) |
- Green bases have known domain annotations that are detailed below.
Human 54 VIEWLRFG--FLLPIFIQFGLYSPRIDPDY-VGRVRLQKGASLQIEGLRVEDQGWYECRVFFLDQ 115
Human 116 HIPEDDFANGSWVHLTV-------NSPPQFQETPPAVLEVQELEPVTLRCVARGSPLPHVTW--- 170
Human 171 -KLRGKDLGQG---QGQVQVQNGTLRIRRVERGSSGVYTCQASSTE------------------- 212
Human 213 ---GSATHATQ 220 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
IGSF9 | NP_001128522.1 | Ig | 24..132 | CDD:299845 | 22/80 (28%) |
IG_like | 28..110 | CDD:214653 | 16/58 (28%) | ||
I-set | 136..223 | CDD:254352 | 26/114 (23%) | ||
Ig | 154..220 | CDD:143165 | 19/94 (20%) | ||
Ig_3 | 226..305 | CDD:290638 | |||
IG_like | 233..319 | CDD:214653 | |||
Ig | 341..404 | CDD:299845 | |||
IG_like | 431..503 | CDD:214653 | |||
Ig | 436..500 | CDD:143165 | |||
fn3 | 511..596 | CDD:278470 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 606..626 | ||||
FN3 | 625..715 | CDD:238020 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 767..919 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 940..988 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1015..1079 | ||||
PDZ-binding. /evidence=ECO:0000250 | 1177..1179 | ||||
dpr13 | NP_001033956.2 | V-set | 180..276 | CDD:284989 | 22/81 (27%) |
IG_like | 182..262 | CDD:214653 | 17/62 (27%) | ||
IG_like | 285..362 | CDD:214653 | 22/82 (27%) | ||
IGc2 | 292..361 | CDD:197706 | 18/74 (24%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |