DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: IGSF9 and dpr13

Sequence 1:NP_001128522.1 Gene:IGSF9 HGNCID:18132 Length:1179 Species:Homo sapiens
Sequence 2:NP_001033956.2 Gene:dpr13 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster

Alignment Length:206 Identity:50/207 (24%)
Similarity:81/207 (39%) Gaps:57/207 (28%)


Human    54 VIEWLRFG--FLLPIFIQFGLYSPRIDPDY-VGRVRLQKGASLQIEGLRVEDQGWYECRVFFLDQ 115
            |:.|:|..  .||.:    ||.:...|..: ...::..:..:|||:.:::.|.|.|||:|   ..
  Fly   206 VVSWIRKKDYHLLTV----GLTTYSSDERFSATHLKHSEDWTLQIKFVQLRDAGVYECQV---ST 263

Human   116 HIPEDDFANGSWVHLTV-------NSPPQFQETPPAVLEVQELEPVTLRCVARGSPLPHVTW--- 170
            |.|...|     :||:|       ..||....||.:.|.:|      .|.|.......::.|   
  Fly   264 HPPTSIF-----LHLSVV
EARAEITGPPIRYLTPGSTLRLQ------CRVVQNTEASEYIFWYHD 317

Human   171 -KLRGKDLGQG---QGQVQVQNGTLRIRRVERGSSGVYTCQASSTE------------------- 212
             ::...|:.:|   ..:...|:..|.|:|..|..||.:||.||:|:                   
  Fly   318 NRMINYDIDRGINVSTEPDFQSSELTIQRTRREHSGNFTCVASNTQPASVLVHIFKGDNPAAMYH 382

Human   213 ---GSATHATQ 220
               |.:|..||
  Fly   383 GHVGGSTKTTQ 393

Known Domains:


GeneSequenceDomainRegion External IDIdentity
IGSF9NP_001128522.1 Ig 24..132 CDD:299845 22/81 (27%)
IG_like 28..110 CDD:214653 16/59 (27%)
I-set 136..223 CDD:254352 26/115 (23%)
Ig 154..220 CDD:143165 20/95 (21%)
Ig_3 226..305 CDD:290638
IG_like 233..319 CDD:214653
Ig 341..404 CDD:299845
IG_like 431..503 CDD:214653
Ig 436..500 CDD:143165
fn3 511..596 CDD:278470
FN3 625..715 CDD:238020
PDZ-binding. {ECO:0000250} 1177..1179
dpr13NP_001033956.2 V-set 180..276 CDD:284989 23/82 (28%)
IG_like 182..262 CDD:214653 17/63 (27%)
IG_like 285..362 CDD:214653 22/83 (27%)
IGc2 292..361 CDD:197706 19/75 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.