DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: IGSF9 and Dscam2

Sequence 1:NP_001128522.1 Gene:IGSF9 HGNCID:18132 Length:1179 Species:Homo sapiens
Sequence 2:NP_001261500.1 Gene:Dscam2 FlyBaseID:FBgn0265296 Length:2101 Species:Drosophila melanogaster

Alignment Length:1368 Identity:301/1369 (22%)
Similarity:444/1369 (32%) Gaps:427/1369 (31%)


Human     8 AVLSLVISQGADGRGKPEVVSVVGRAGESVVLGCDLLPPAGRP-PLHVIEWLRFGFLLPIFIQFG 71
            |.|.|.::........|.|:||  ..|.:....| |:...|.| .:..|.|.:.|..||      
  Fly   321 AELRLTVATPIQVEISPNVLSV--HMGGTAEFRC-LVTSNGSPVGMQNILWYKDGRQLP------ 376

Human    72 LYSPRIDPDYVGRVRLQKGASLQIEGLRVEDQGWYECRVFFLDQHIPEDDFANGSWVHLTVNSPP 136
                     ..|||.    .:|.:..:..|::|.|:|.|     ..||.|         |..:..
  Fly   377 ---------SSGRVE----DTLVVPRVSRENRGMYQCVV-----RRPEGD---------TFQATA 414

Human   137 QFQ--ETPPAVLE---VQELEP---VTLRCVARGSPLPHVTWKLRGKDL-GQGQ---GQVQVQNG 189
            :.|  :.||.:|.   .|.|:|   |:|:|.|.|:|.|.::|.|.|..| ..|:   ||....:|
  Fly   415 ELQLGDAPPVLLYSFIEQTLQPGPAVSLKCSAAGNPTPQISWTLDGFPLPSNGRFMIGQYITVHG 479

Human   190 T----LRIRRVERGSSGVYTCQASSTEGSATHATQLLVLGPPVIVVPPKNSTVNASQDVSLACHA 250
            .    :.|..|.....|.|.|.|.:..|...||.:|.:.|.|.|.:.||.:.| :.:.::|.|..
  Fly   480 DVISHVNISHVMVEDGGEYACIAENRAGRVQHAARLNIYGLPYIRLIPKVTAV-SGETLNLKCPV 543

Human   251 EAYPANLTYSW------FQDNINVFHISRLQPRVRILVDGSLRLLATQPD-DAGCYTCVPSNGLL 308
            ..||....: |      ..|:|.    .|:||      ||||.:...|.: |:|.|||...|...
  Fly   544 AGYPIEEIH-WERGGRELPDDIR----QRVQP------DGSLTISPVQKNSDSGVYTCWARNKQG 597

Human   309 HPPSASAYLTVLYPAQVTAMPPET---PLPIGMPGVIRCPVRANPPLLFVSWTKDGKALQLDKFP 370
            |....|..:||:.|.:::  |.:|   .|.:|....:.|.|......|.::|.|||:.:...:..
  Fly   598 HSARRSGEVTVIVPPKLS--PFQTNILQLNMGDRASLTCSVVKGDLPLTINWRKDGRPIDPTQHM 660

Human   371 GWSQGTEGSLIIALGN--EDALGEYSCTPYNSLGTAGPSPVTRVLLKAPPAFIERPKEEYFQEVG 433
            ...|..:.:.|:.:.|  .|..|.|||...||......|..  :|:..||.:|..|.:... |..
  Fly   661 SVKQVDQYNSILVIENLGSDHTGNYSCVVRNSAAEVENSQA--LLVNVPPRWIVEPVDANV-ERN 722

Human   434 RELLIPCSAQGDPPPVVSWTKVGRGLQGQ---------AQVDSNSSLILRPLTKEAHGHWECSAS 489
            |.:::.|.|||.|.|.:.|.|......|:         .::..|.||:|:.:.::..|.:.|.|:
  Fly   723 RHIMLHCQAQGVPTPSIVWKKATGSKSGEYEEVRERPFTKLLGNGSLLLQHVKEDREGFYLCQAN 787

Human   490 NA-------VARVATSTNVYVLGTSPHVVTNVSVVAL-------PKGANVSWEPGFDGGYLQRFS 540
            |.       |.::..:::.|...||..|:......||       .|..|:.|             
  Fly   788 NGIGTGIGKVIQLKVNSSPYFSSTSRSVMVKKGDTALLQCAVSGDKPINIVW------------- 839

Human   541 VWYTPLAKRPDRMHHDWVSLAVPVGAAHLLVPG---LQPHTQYQFSVLAQNKLGSGPFSEIVLSA 602
                                         :..|   |.|.|.|:.|| .|.....|..:|:.:..
  Fly   840 -----------------------------MRSGKNTLNPSTNYKISV-KQEATPDGVSAELQIRT 874

Human   603 PEGLPTTPAAP-------------GLPPTEIPPPLSPPRGL-VAVRTPRGVLLHWDPPELVPKRL 653
               :..|.:.|             .|...::..|..||..| .|:.:.|.|.:.|.|..|....:
  Fly   875 ---VDATDSGPYFCRASNLYGNDQQLVQLQVQEPPLPPSVLEAAMISSRSVNIKWQPKTLGTGDV 936

Human   654 DGYVLEGRQGSQG---------W---EVLDPAVAGTETELLVPGLIKDVLYEFRLVAFAGSFVSD 706
            ..|::|.|:....         |   ||.||.......|.|.|.    ..|.||::|...:..|.
  Fly   937 TKYIVEFREADHSLPPALFVDQWQQIEVKDPPHFNAMIENLKPA----TRYAFRVIAEGSAGRSA 997

Human   707 PSNTANVSTSGLEVYPSRTQLPGLLPQPVLAGVVGGVCFLGVAVLVSILAGCLLNRRRAARRRRK 771
            ||....|.|.     |.|.                              ||              
  Fly   998 PSQELIVRTE-----PQRP------------------------------AG-------------- 1013

Human   772 RLRQDPPLIFSPTGKSAAPSALGSGSPDSVAKLKLQG-SPVPSLRQSLLWGDPAG---------- 825
                 |||..             |..|.|..:|.:.. :|:|.||...:.|...|          
  Fly  1014 -----PPLSL-------------SARPLSSTELLISWVAPLPELRHGDIQGYNVGYKLSSSGNTA 1060

Human   826 --TPSPHPDPPSSRGPLPLEPICR--------------GPDGRFVMGPTVAAPQERSGREQAEPR 874
              ..|...|.....|.|.|..:.:              ||      || ::.|......|....|
  Fly  1061 YNFTSVSGDGDGGNGELLLSGLAKFARYTVVVQAFNQVGP------GP-LSEPTAAQTMEDVPSR 1118

Human   875 TPAQRLARSFDCSSSSPSGAPQPL----------------CIEDISP-----VAPPPAAPPSPLP 918
            .|......:....|...|..|.|:                .|:||.|     .:....|....|.
  Fly  1119 PPEDVRCAALSSQSLQVSWQPPPIYHTNGLLQGYKLIFEPIIDDIQPSKDEVESRKTTALTMVLT 1183

Human   919 GPGPLLQY--------------LSLPFFREMNVDGDWPPLEEPSPAAPPDYMDTRRCPTSSFLRS 969
            |......|              :|.|.|...         ||..|.||.|..     ..||..:|
  Fly  1184 GLRKYTNYSIQVLAHTRMGDGVVSKPLFCHS---------EEDVPEAPADIK-----VVSSSSQS 1234

Human   970 PETPPVSPRESLPGAVVGAGATAEPPYTALADWTLRERL------LP---------GLLPAAPRG 1019
            .....:.|.|  |..|:    |....||.:.:.  ||.|      ||         ||.|.....
  Fly  1235 LYISWLPPNE--PNGVI----TKYSLYTRVVNG--REELNNEKRSLPSQQAYYEAKGLHPHMEYQ 1291

Human  1020 SLTSQSS--GRGSASFL-------RPPSTAPSAGGSYLSPAPGDTSSWAS---------GPERWP 1066
            ...:.|:  |.|.:|.:       |.|:...|.||..:.|       |.|         |.   |
  Fly  1292 FWVTASTRVGEGKSSRVSSQITTNRIPARIISFGGPVVRP-------WRSTVTLPCTAVGK---P 1346

Human  1067 RREHVVTVSKRRNTSVDENYEWDSEFPGDMELLETLHL------------GLASSRLR------- 1112
            :||...:....|...:..:...||   ||: ::.:|.|            |:.:.||.       
  Fly  1347 KREWFKSDVALRQGGLHNSQLLDS---GDL-IISSLQLADGGNYSCQVDNGIGTDRLTHTLIVQV 1407

Human  1113 PEAEPELGVKTPEEGCLL--------NTAHVTGPEARCAALREEFLAFRRRRDATRARLPAYRQP 1169
            |...|.|.|.:.....:|        ..|.:||           :..|.||.:.....:...|..
  Fly  1408 PPTAPVLYVTSATSSSILMHWKCGFTGNAPITG-----------YTLFYRRANGNTDEMQLSRHA 1461

Human  1170 VPH 1172
            ..|
  Fly  1462 SSH 1464

Known Domains:


GeneSequenceDomainRegion External IDIdentity
IGSF9NP_001128522.1 Ig 24..132 CDD:299845 27/109 (25%)
IG_like 28..110 CDD:214653 20/83 (24%)
I-set 136..223 CDD:254352 32/103 (31%)
Ig 154..220 CDD:143165 24/74 (32%)
Ig_3 226..305 CDD:290638 25/86 (29%)
IG_like 233..319 CDD:214653 27/93 (29%)
Ig 341..404 CDD:299845 17/65 (26%)
IG_like 431..503 CDD:214653 21/88 (24%)
Ig 436..500 CDD:143165 18/80 (23%)
fn3 511..596 CDD:278470 14/95 (15%)
FN3 625..715 CDD:238020 28/103 (27%)
PDZ-binding. {ECO:0000250} 1177..1179
Dscam2NP_001261500.1 Ig 51..127 CDD:299845
Ig 138..>203 CDD:299845
I-set 238..327 CDD:254352 3/6 (50%)
Ig 247..327 CDD:299845 3/6 (50%)
I-set 332..418 CDD:254352 28/122 (23%)
IGc2 344..407 CDD:197706 21/88 (24%)
IG_like 432..517 CDD:214653 28/85 (33%)
IGc2 436..507 CDD:197706 22/71 (31%)
I-set 521..610 CDD:254352 30/101 (30%)
IGc2 533..597 CDD:197706 21/75 (28%)
Ig 630..699 CDD:143165 17/69 (25%)
IG_like 714..802 CDD:214653 21/89 (24%)
Ig 725..802 CDD:299845 18/77 (23%)
Ig 823..894 CDD:143165 17/117 (15%)
FN3 906..1006 CDD:238020 28/104 (27%)
FN3 1013..1111 CDD:238020 24/137 (18%)
FN3 1119..1209 CDD:238020 14/90 (16%)
FN3 1219..1313 CDD:238020 26/107 (24%)
Ig 1336..1402 CDD:143165 14/73 (19%)
FN3 1409..1498 CDD:238020 12/68 (18%)
FN3 1515..1588 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.