DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IGSF9 and Dscam2

DIOPT Version :10

Sequence 1:NP_001128522.1 Gene:IGSF9 / 57549 HGNCID:18132 Length:1179 Species:Homo sapiens
Sequence 2:NP_001261500.1 Gene:Dscam2 / 38788 FlyBaseID:FBgn0265296 Length:2101 Species:Drosophila melanogaster


Alignment Length:1368 Identity:301/1368 - (22%)
Similarity:444/1368 - (32%) Gaps:427/1368 - (31%)


- Green bases have known domain annotations that are detailed below.


Human     8 AVLSLVISQGADGRGKPEVVSVVGRAGESVVLGCDLLPPAGRP-PLHVIEWLRFGFLLPIFIQFG 71
            |.|.|.::........|.|:||  ..|.:....| |:...|.| .:..|.|.:.|..||      
  Fly   321 AELRLTVATPIQVEISPNVLSV--HMGGTAEFRC-LVTSNGSPVGMQNILWYKDGRQLP------ 376

Human    72 LYSPRIDPDYVGRVRLQKGASLQIEGLRVEDQGWYECRVFFLDQHIPEDDFANGSWVHLTVNSPP 136
                     ..|||.    .:|.:..:..|::|.|:|.|     ..||.|         |..:..
  Fly   377 ---------SSGRVE----DTLVVPRVSRENRGMYQCVV-----RRPEGD---------TFQATA 414

Human   137 QFQ--ETPPAVLE---VQELEP---VTLRCVARGSPLPHVTWKLRGKDL-GQGQ---GQVQVQNG 189
            :.|  :.||.:|.   .|.|:|   |:|:|.|.|:|.|.::|.|.|..| ..|:   ||....:|
  Fly   415 ELQLGDAPPVLLYSFIEQTLQPGPAVSLKCSAAGNPTPQISWTLDGFPLPSNGRFMIGQYITVHG 479

Human   190 T----LRIRRVERGSSGVYTCQASSTEGSATHATQLLVLGPPVIVVPPKNSTVNASQDVSLACHA 250
            .    :.|..|.....|.|.|.|.:..|...||.:|.:.|.|.|.:.||.:.| :.:.::|.|..
  Fly   480 DVISHVNISHVMVEDGGEYACIAENRAGRVQHAARLNIYGLPYIRLIPKVTAV-SGETLNLKCPV 543

Human   251 EAYPANLTYSW------FQDNINVFHISRLQPRVRILVDGSLRLLATQPD-DAGCYTCVPSNGLL 308
            ..||....: |      ..|:|.    .|:||      ||||.:...|.: |:|.|||...|...
  Fly   544 AGYPIEEIH-WERGGRELPDDIR----QRVQP------DGSLTISPVQKNSDSGVYTCWARNKQG 597

Human   309 HPPSASAYLTVLYPAQVTAMPPET---PLPIGMPGVIRCPVRANPPLLFVSWTKDGKALQLDKFP 370
            |....|..:||:.|.:::  |.:|   .|.:|....:.|.|......|.::|.|||:.:...:..
  Fly   598 HSARRSGEVTVIVPPKLS--PFQTNILQLNMGDRASLTCSVVKGDLPLTINWRKDGRPIDPTQHM 660

Human   371 GWSQGTEGSLIIALGN--EDALGEYSCTPYNSLGTAGPSPVTRVLLKAPPAFIERPKEEYFQEVG 433
            ...|..:.:.|:.:.|  .|..|.|||...||......|..  :|:..||.:|..|.:... |..
  Fly   661 SVKQVDQYNSILVIENLGSDHTGNYSCVVRNSAAEVENSQA--LLVNVPPRWIVEPVDANV-ERN 722

Human   434 RELLIPCSAQGDPPPVVSWTKVGRGLQGQ---------AQVDSNSSLILRPLTKEAHGHWECSAS 489
            |.:::.|.|||.|.|.:.|.|......|:         .::..|.||:|:.:.::..|.:.|.|:
  Fly   723 RHIMLHCQAQGVPTPSIVWKKATGSKSGEYEEVRERPFTKLLGNGSLLLQHVKEDREGFYLCQAN 787

Human   490 NA-------VARVATSTNVYVLGTSPHVVTNVSVVAL-------PKGANVSWEPGFDGGYLQRFS 540
            |.       |.::..:::.|...||..|:......||       .|..|:.|             
  Fly   788 NGIGTGIGKVIQLKVNSSPYFSSTSRSVMVKKGDTALLQCAVSGDKPINIVW------------- 839

Human   541 VWYTPLAKRPDRMHHDWVSLAVPVGAAHLLVPG---LQPHTQYQFSVLAQNKLGSGPFSEIVLSA 602
                                         :..|   |.|.|.|:.|| .|.....|..:|:.:..
  Fly   840 -----------------------------MRSGKNTLNPSTNYKISV-KQEATPDGVSAELQIRT 874

Human   603 PEGLPTTPAAP-------------GLPPTEIPPPLSPPRGL-VAVRTPRGVLLHWDPPELVPKRL 653
               :..|.:.|             .|...::..|..||..| .|:.:.|.|.:.|.|..|....:
  Fly   875 ---VDATDSGPYFCRASNLYGNDQQLVQLQVQEPPLPPSVLEAAMISSRSVNIKWQPKTLGTGDV 936

Human   654 DGYVLEGRQGSQG---------W---EVLDPAVAGTETELLVPGLIKDVLYEFRLVAFAGSFVSD 706
            ..|::|.|:....         |   ||.||.......|.|.|.    ..|.||::|...:..|.
  Fly   937 TKYIVEFREADHSLPPALFVDQWQQIEVKDPPHFNAMIENLKPA----TRYAFRVIAEGSAGRSA 997

Human   707 PSNTANVSTSGLEVYPSRTQLPGLLPQPVLAGVVGGVCFLGVAVLVSILAGCLLNRRRAARRRRK 771
            ||....|.|.     |.|.                              ||              
  Fly   998 PSQELIVRTE-----PQRP------------------------------AG-------------- 1013

Human   772 RLRQDPPLIFSPTGKSAAPSALGSGSPDSVAKLKLQG-SPVPSLRQSLLWGDPAG---------- 825
                 |||..             |..|.|..:|.:.. :|:|.||...:.|...|          
  Fly  1014 -----PPLSL-------------SARPLSSTELLISWVAPLPELRHGDIQGYNVGYKLSSSGNTA 1060

Human   826 --TPSPHPDPPSSRGPLPLEPICR--------------GPDGRFVMGPTVAAPQERSGREQAEPR 874
              ..|...|.....|.|.|..:.:              ||      || ::.|......|....|
  Fly  1061 YNFTSVSGDGDGGNGELLLSGLAKFARYTVVVQAFNQVGP------GP-LSEPTAAQTMEDVPSR 1118

Human   875 TPAQRLARSFDCSSSSPSGAPQPL----------------CIEDISP-----VAPPPAAPPSPLP 918
            .|......:....|...|..|.|:                .|:||.|     .:....|....|.
  Fly  1119 PPEDVRCAALSSQSLQVSWQPPPIYHTNGLLQGYKLIFEPIIDDIQPSKDEVESRKTTALTMVLT 1183

Human   919 GPGPLLQY--------------LSLPFFREMNVDGDWPPLEEPSPAAPPDYMDTRRCPTSSFLRS 969
            |......|              :|.|.|...         ||..|.||.|..     ..||..:|
  Fly  1184 GLRKYTNYSIQVLAHTRMGDGVVSKPLFCHS---------EEDVPEAPADIK-----VVSSSSQS 1234

Human   970 PETPPVSPRESLPGAVVGAGATAEPPYTALADWTLRERL------LP---------GLLPAAPRG 1019
            .....:.|.|  |..|:    |....||.:.:.  ||.|      ||         ||.|.....
  Fly  1235 LYISWLPPNE--PNGVI----TKYSLYTRVVNG--REELNNEKRSLPSQQAYYEAKGLHPHMEYQ 1291

Human  1020 SLTSQSS--GRGSASFL-------RPPSTAPSAGGSYLSPAPGDTSSWAS---------GPERWP 1066
            ...:.|:  |.|.:|.:       |.|:...|.||..:.|       |.|         |.   |
  Fly  1292 FWVTASTRVGEGKSSRVSSQITTNRIPARIISFGGPVVRP-------WRSTVTLPCTAVGK---P 1346

Human  1067 RREHVVTVSKRRNTSVDENYEWDSEFPGDMELLETLHL------------GLASSRLR------- 1112
            :||...:....|...:..:...||   ||: ::.:|.|            |:.:.||.       
  Fly  1347 KREWFKSDVALRQGGLHNSQLLDS---GDL-IISSLQLADGGNYSCQVDNGIGTDRLTHTLIVQV 1407

Human  1113 PEAEPELGVKTPEEGCLL--------NTAHVTGPEARCAALREEFLAFRRRRDATRARLPAYRQP 1169
            |...|.|.|.:.....:|        ..|.:||           :..|.||.:.....:...|..
  Fly  1408 PPTAPVLYVTSATSSSILMHWKCGFTGNAPITG-----------YTLFYRRANGNTDEMQLSRHA 1461

Human  1170 VPH 1172
            ..|
  Fly  1462 SSH 1464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IGSF9NP_001128522.1 IG_like 28..110 CDD:214653 20/82 (24%)
Ig strand B 37..41 CDD:409353 0/3 (0%)
Ig strand C 54..58 CDD:409353 1/3 (33%)
Ig strand E 91..95 CDD:409353 1/3 (33%)
Ig 136..223 CDD:472250 32/102 (31%)
Ig strand B 154..158 CDD:409353 2/3 (67%)
Ig strand C 167..171 CDD:409353 0/3 (0%)
Ig strand E 189..193 CDD:409353 1/7 (14%)
Ig strand F 203..208 CDD:409353 2/4 (50%)
Ig_3 226..305 CDD:464046 25/85 (29%)
Ig <341..404 CDD:472250 17/64 (27%)
Ig strand B 341..344 CDD:409353 0/2 (0%)
Ig strand C 353..358 CDD:409353 1/4 (25%)
Ig strand E 378..382 CDD:409353 0/3 (0%)
Ig strand F 392..397 CDD:409353 3/4 (75%)
Ig 418..503 CDD:472250 23/100 (23%)
Ig strand B 436..440 CDD:409570 0/3 (0%)
Ig strand C 449..453 CDD:409570 0/3 (0%)
Ig strand E 469..473 CDD:409570 2/3 (67%)
FN3 482..>717 CDD:442628 57/277 (21%)
Ig strand F 483..488 CDD:409570 1/4 (25%)
Ig strand G 496..499 CDD:409570 0/2 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 606..626 4/32 (13%)
FN3 625..715 CDD:238020 28/102 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 767..919 36/199 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 940..988 13/47 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1015..1079 16/81 (20%)
PDZ-binding. /evidence=ECO:0000250 1177..1179
Dscam2NP_001261500.1 Ig 30..128 CDD:472250
Ig strand B 49..53 CDD:409353
Ig strand C 62..66 CDD:409353
Ig strand E 86..90 CDD:409353
Ig strand F 106..111 CDD:409353
Ig strand G 119..123 CDD:409353
V-set 138..229 CDD:462230
Ig 238..327 CDD:472250 3/5 (60%)
Ig strand B 255..259 CDD:409353
Ig strand C 268..272 CDD:409353
Ig strand E 293..297 CDD:409353
Ig strand F 307..312 CDD:409353
Ig strand G 320..323 CDD:409353 1/1 (100%)
Ig 330..418 CDD:472250 27/123 (22%)
Ig strand B 348..352 CDD:409353 0/3 (0%)
Ig strand C 365..369 CDD:409353 1/3 (33%)
Ig strand E 383..387 CDD:409353 1/3 (33%)
Ig strand F 397..402 CDD:409353 2/4 (50%)
Ig strand G 411..414 CDD:409353 0/2 (0%)
IgI_4_Dscam 422..517 CDD:409548 31/94 (33%)
Ig strand A 422..425 CDD:409548 2/2 (100%)
Ig strand A' 431..435 CDD:409548 1/3 (33%)
Ig strand B 438..447 CDD:409548 3/8 (38%)
Ig strand C 452..458 CDD:409548 2/5 (40%)
Ig strand C' 460..463 CDD:409548 1/2 (50%)
Ig strand D 468..476 CDD:409548 2/7 (29%)
Ig strand E 480..489 CDD:409548 1/8 (13%)
Ig strand F 496..504 CDD:409548 4/7 (57%)
Ig strand G 507..517 CDD:409548 4/9 (44%)
IgI_5_Dscam 521..608 CDD:409550 28/98 (29%)
Ig strand A 521..523 CDD:409550 1/1 (100%)
Ig strand A' 528..532 CDD:409550 1/3 (33%)
Ig strand B 535..542 CDD:409550 1/6 (17%)
Ig strand C 549..555 CDD:409550 1/6 (17%)
Ig strand C' 556..558 CDD:409550 0/1 (0%)
Ig strand D 565..569 CDD:409550 1/7 (14%)
Ig strand E 572..578 CDD:409550 3/5 (60%)
Ig strand F 586..594 CDD:409550 4/7 (57%)
Ig strand G 598..608 CDD:409550 2/9 (22%)
Ig 611..704 CDD:472250 23/96 (24%)
Ig strand B 630..634 CDD:409353 0/3 (0%)
Ig strand C 644..648 CDD:409353 0/3 (0%)
Ig strand E 670..674 CDD:409353 1/3 (33%)
Ig strand F 684..689 CDD:409353 3/4 (75%)
Ig strand G 697..700 CDD:409353 0/2 (0%)
IgI_7_Dscam 707..802 CDD:409546 24/95 (25%)
Ig strand A 707..711 CDD:409546 2/3 (67%)
Ig strand A' 716..720 CDD:409546 0/4 (0%)
Ig strand B 723..732 CDD:409546 2/8 (25%)
Ig strand C 738..744 CDD:409546 1/5 (20%)
Ig strand C' 750..753 CDD:409546 1/2 (50%)
Ig strand D 761..764 CDD:409546 0/2 (0%)
Ig strand E 767..773 CDD:409546 3/5 (60%)
Ig strand F 780..788 CDD:409546 3/7 (43%)
Ig strand G 793..802 CDD:409546 1/8 (13%)
Ig 806..892 CDD:472250 21/131 (16%)
Ig strand B 823..827 CDD:409353 2/3 (67%)
Ig strand C 836..840 CDD:409353 2/45 (4%)
Ig strand E 868..872 CDD:409353 1/3 (33%)
Ig strand F 882..887 CDD:409353 1/4 (25%)
FN3 <904..1195 CDD:442628 72/368 (20%)
FN3 906..1006 CDD:238020 28/103 (27%)
fn3 1221..1306 CDD:394996 24/97 (25%)
Ig 1336..1396 CDD:409353 12/66 (18%)
Ig strand B 1336..1340 CDD:409353 0/3 (0%)
Ig strand E 1371..1375 CDD:409353 2/4 (50%)
Ig strand F 1385..1390 CDD:409353 0/4 (0%)
FN3 <1407..>1606 CDD:442628 13/69 (19%)
fn3 1408..1491 CDD:394996 13/68 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.