DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: IGSF9 and ImpL2

Sequence 1:NP_001128522.1 Gene:IGSF9 HGNCID:18132 Length:1179 Species:Homo sapiens
Sequence 2:NP_728961.2 Gene:ImpL2 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster

Alignment Length:252 Identity:53/253 (21%)
Similarity:94/253 (37%) Gaps:77/253 (30%)


Human   114 DQHIPEDDFANGSWVHLTVNSPPQFQETPPAVLEVQELEPVTLRCVARGSPLPHVTWKL----RG 174
            ::..|.:......|:        :|.:|||..|:..:...:.:.|...||.:|.:.|.:    |.
  Fly    44 EEEKPRNRAFEADWL--------KFTKTPPTKLQQADGATIEIVCEMMGSQVPSIQWVVGHLPRS 100

Human   175 K--DLGQGQGQVQVQNGTLRIRRVERGSSGV----------YTCQASSTEGSATHATQLLVLGPP 227
            :  ||...|...:..:..:|:|     ||.:          |||...:  ||.|       :...
  Fly   101 ELDDLDSNQVAEEAPSAIVRVR-----SSHIIDHVLSEARTYTCVGRT--GSKT-------IYAS 151

Human   228 VIVVPPKNSTVNASQ-----------------------DVSLACHAEAYP-ANLTYSWF-QDNIN 267
            .:|.||::|.:...:                       ::.|.|...|.| |.:|  |. .:|..
  Fly   152 TVVHPPRSSRLTPEKTYPGAQKPRIIYTEKTHLDLMGSNIQLPCRVHARPRAEIT--WLNNENKE 214

Human   268 VF--HISRLQPRVRILVDGSLRLLATQPDDAGCYTCVPSNGLLHPPSASAYLTVLYP 322
            :.  |      |.|:|.:|.|.:...:.:|.|.|.|:..| ::...:|.   |.:||
  Fly   215 IVQGH------RHRVLANGDLLISEIKWEDMGNYKCIARN-VVGKDTAD---TFVYP 261

Known Domains:


GeneSequenceDomainRegion External IDIdentity
IGSF9NP_001128522.1 Ig 24..132 CDD:299845 2/18 (11%)
IG_like 28..110 CDD:214653
I-set 136..223 CDD:254352 24/103 (23%)
Ig 154..220 CDD:143165 19/82 (23%)
Ig_3 226..305 CDD:290638 22/106 (21%)
IG_like 233..319 CDD:214653 23/113 (20%)
Ig 341..404 CDD:299845
IG_like 431..503 CDD:214653
Ig 436..500 CDD:143165
fn3 511..596 CDD:278470
FN3 625..715 CDD:238020
PDZ-binding. {ECO:0000250} 1177..1179
ImpL2NP_728961.2 IGc2 187..251 CDD:197706 19/73 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.