DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: IGSF9 and dpr20

Sequence 1:NP_001128522.1 Gene:IGSF9 HGNCID:18132 Length:1179 Species:Homo sapiens
Sequence 2:NP_612066.1 Gene:dpr20 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster

Alignment Length:266 Identity:58/267 (22%)
Similarity:95/267 (36%) Gaps:89/267 (33%)


Human    25 EVVSVVGRAGESVVLGC--DLLPPAGRPPLHVIEWLRF---------GFLLPIFIQFGLYSPRID 78
            :..::..:||.|:.|.|  .||..      ..:.|:|.         |..|.: :..|:::...|
  Fly   275 QATNLTVQAGSSIHLNCRISLLQD------KTVSWVRHNTQDEGKDNGNALDL-LTVGMHTYTGD 332

Human    79 PDYVGRVRLQKGASLQIEGLRVEDQGWYECRVFFLDQHIPEDDFANGSWVHLTVNSPPQFQETPP 143
            ..|....:......|:|..::.:|:..|||::   ..|.|     ....::|.||:        |
  Fly   333 KRYKMEFQYPNNWRLKITNVKKDDEAIYECQI---STHPP-----RVIQINLHVNA--------P 381

Human   144 AVLEVQEL-EP-----------VTLRCVARGSPLPH--VTWK----LRGKDLGQGQGQVQVQ--- 187
            .|:.|.|: :|           :.|.||.|...:..  |.||    :...|:.:|...|:.:   
  Fly   382 KVMIVDEVGDPLQEKYYEIDSTLQLSCVVRNVAMTSSVVFWKHMDNILNYDVTRGGVSVKTELME 446

Human   188 ---NGTLRIRRVERGSSGVYTCQASSTE-------------------GSAT------------HA 218
               |.||.|.::.:..||.|||..|..:                   |.|.            ||
  Fly   447 DGANSTLSIAKISKTDSGNYTCSISEFQNFTIVVHILNGESFAELHHGGAVGWHSTWWNMVMLHA 511

Human   219 TQLLVL 224
            ..||||
  Fly   512 MALLVL 517

Known Domains:


GeneSequenceDomainRegion External IDIdentity
IGSF9NP_001128522.1 Ig 24..132 CDD:299845 23/118 (19%)
IG_like 28..110 CDD:214653 20/93 (22%)
I-set 136..223 CDD:254352 31/142 (22%)
Ig 154..220 CDD:143165 24/109 (22%)
Ig_3 226..305 CDD:290638
IG_like 233..319 CDD:214653
Ig 341..404 CDD:299845
IG_like 431..503 CDD:214653
Ig 436..500 CDD:143165
fn3 511..596 CDD:278470
FN3 625..715 CDD:238020
PDZ-binding. {ECO:0000250} 1177..1179
dpr20NP_612066.1 IG_like 278..365 CDD:214653 20/97 (21%)
Ig 279..378 CDD:299845 23/114 (20%)
Ig 400..471 CDD:299845 19/71 (27%)
IG_like 402..480 CDD:214653 20/78 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.