DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: IGSF9 and babos

Sequence 1:NP_001128522.1 Gene:IGSF9 HGNCID:18132 Length:1179 Species:Homo sapiens
Sequence 2:NP_001286719.1 Gene:babos FlyBaseID:FBgn0034724 Length:196 Species:Drosophila melanogaster

Alignment Length:247 Identity:50/248 (20%)
Similarity:77/248 (31%) Gaps:92/248 (37%)


Human   114 DQHIPEDDFANGSWVHLTVNSPPQFQETPPAVLEVQELEPVTLRCVARGSPLPHVTWKLRGKDLG 178
            ||...:|||..|.          :.|..|         .|.|      .||.|..:.|:      
  Fly    32 DQMQADDDFDYGG----------EDQSAP---------SPQT------KSPNPVASEKI------ 65

Human   179 QGQGQVQVQNGTLRIRRVERGSSGVYTCQASSTEGSATHATQLLVLGPPVIVVPPKNSTVNASQD 243
                     |.||.:..: ||...|..|..    ||..|::.::||                   
  Fly    66 ---------NKTLSVTGI-RGEDVVLKCDV----GSNLHSSDVVVL------------------- 97

Human   244 VSLACHAEAYPANLTYSW-FQDNINVFHISRLQPRVRILVDGSLRLLATQPDDAGCYTC--VPSN 305
                             | |.||:.....:.:||..::..:..|.:|...|..||.|.|  :||.
  Fly    98 -----------------WYFGDNVISNGKNLVQPNFKLDANYDLTILKASPQVAGSYLCKVLPSG 145

Human   306 GLLHPPSASAYLTVLYPAQVTAMPPE--TPLPIGMPGVIRCPVRANPPLLFV 355
            .:::..      ..:....:.|:.||  |.........:.|.|.|:..||.:
  Fly   146 SVVNTK------VTIAEHSLDAIAPESSTSAAGSASSFLGCTVLASTVLLLL 191

Known Domains:


GeneSequenceDomainRegion External IDIdentity
IGSF9NP_001128522.1 Ig 24..132 CDD:299845 6/18 (33%)
IG_like 28..110 CDD:214653
I-set 136..223 CDD:254352 18/87 (21%)
Ig 154..220 CDD:143165 15/66 (23%)
Ig_3 226..305 CDD:290638 15/82 (18%)
IG_like 233..319 CDD:214653 15/89 (17%)
Ig 341..404 CDD:299845 5/16 (31%)
IG_like 431..503 CDD:214653
Ig 436..500 CDD:143165
fn3 511..596 CDD:278470
FN3 625..715 CDD:238020
PDZ-binding. {ECO:0000250} 1177..1179
babosNP_001286719.1 ig 70..154 CDD:278476 24/131 (18%)
IG_like 70..154 CDD:214653 24/131 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.