DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: IGSF9 and wrapper

Sequence 1:NP_001128522.1 Gene:IGSF9 HGNCID:18132 Length:1179 Species:Homo sapiens
Sequence 2:NP_477404.1 Gene:wrapper FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster

Alignment Length:526 Identity:118/527 (22%)
Similarity:179/527 (34%) Gaps:143/527 (27%)


Human   113 LDQHIPEDDFANGSWVHLTVNSPPQFQETPPAVLEVQELEPVTLRCVARGSPLPHVTW------- 170
            |.|...|.||.|      .:.:..:|:..|..| :..|.:.|.|.|.. .:|..:|.|       
  Fly    18 LGQVQAELDFNN------DLENSQKFKSIPTTV-KTYENDTVQLPCTL-NTPFRYVRWHRDDVAL 74

Human   171 -KLRGKDLGQGQGQVQVQNGTLRIRRVERGSSGVYTCQASSTEGSAT--HATQLLVLGPPVIVVP 232
             ..|..:|......:...||:|::..|:...:|.|.|:.:|..|...  ||.: :.|.|.|::.|
  Fly    75 VDSRHPELPPPDRIMLWPNGSLQVANVQSSDTGDYYCEMNSDSGHVVQQHAIE-VQLAPQVLIEP 138

Human   233 PKNSTVNASQDVSLACHAEAYPANLTYSWFQDNINVFHISRLQPRVRILVDGSLRLLATQPDDAG 297
            ...:.........:.|.|:..|..: .:| :.|.||     :||:.......||.|.....:.||
  Fly   139 SDLTEQRIGAIFEVVCEAQGVPQPV-ITW-RLNGNV-----IQPQSNTGNRQSLILEIKSRNQAG 196

Human   298 CYTCVPSNGLLHPPSASAYLTVLYPAQVTAMPPETPLPIGMPGVIRCPVRANPPLLFVSWTKDGK 362
            ...||.|||:..|..|:.||.||:..:|:...|.....:|....:.|.|.| .|...|.|...|.
  Fly   197 LIECVASNGVGEPAVANVYLHVLFSPEVSIPQPVVYTKLGSRAHLECIVEA-APAATVKWFHHGL 260

Human   363 ALQLDKFPGWSQGTEGSLIIALGNEDALGEYSCTPYNSLGTAGPSPVTRVLLKAPPAFIERPKEE 427
            .:                        |||.:|.|..:.|.|                  .|..:.
  Fly   261 PV------------------------ALGAHSTTHESELQT------------------NRSVDH 283

Human   428 YFQEVGRELLIPCSAQGDPPPVVSWTKVGRGLQGQAQVDSNSSLILRPLTKEAHGHWECSASNAV 492
            |...| |.:|:..|.:                        |:.:          |.:||.|||.:
  Fly   284 YVNAV-RHMLVVKSVR------------------------NADM----------GQYECRASNQI 313

Human   493 ARVATSTNVYVLGTSPHVVTNVSVVALPKGANVSWEPGFDGGYLQRFSVWYT------------- 544
            :..:.|               |.:...|........||.... .....||.|             
  Fly   314 SVKSGS---------------VELTGRPMPCLFKINPGTQSS-TSHVLVWQTESLLPIMEFKLKF 362

Human   545 ---PLAKRPDRMHHDWVSLAVPVGAAHLLV-------PGLQPHTQYQFSVLAQNKLGSGPFSEIV 599
               |......::..:|..|.:|..|.:.|:       .||||.:.|:.||||:|..|....|:||
  Fly   363 RQIPSNNVTRQVRTNWTELTIPAQATNGLIYITTYTLHGLQPASLYEVSVLARNSFGWSDNSKIV 427

Human   600 LSAPEG 605
            ..|..|
  Fly   428 RFATGG 433

Known Domains:


GeneSequenceDomainRegion External IDIdentity
IGSF9NP_001128522.1 Ig 24..132 CDD:299845 6/19 (32%)
IG_like 28..110 CDD:214653
I-set 136..223 CDD:254352 23/97 (24%)
Ig 154..220 CDD:143165 19/76 (25%)
Ig_3 226..305 CDD:290638 20/79 (25%)
IG_like 233..319 CDD:214653 23/86 (27%)
Ig 341..404 CDD:299845 14/63 (22%)
IG_like 431..503 CDD:214653 12/72 (17%)
Ig 436..500 CDD:143165 10/64 (16%)
fn3 511..596 CDD:278470 24/108 (22%)
FN3 625..715 CDD:238020
PDZ-binding. {ECO:0000250} 1177..1179
wrapperNP_477404.1 Ig 41..124 CDD:299845 20/85 (24%)
IG_like 41..118 CDD:214653 19/79 (24%)
IG_like 145..218 CDD:214653 23/80 (29%)
Ig 147..219 CDD:299845 24/79 (30%)
I-set 224..323 CDD:254352 32/192 (17%)
IGc2 236..314 CDD:197706 28/156 (18%)
FN3 339..431 CDD:238020 24/93 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.