DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: IGSF9 and Strn-Mlck

Sequence 1:NP_001128522.1 Gene:IGSF9 HGNCID:18132 Length:1179 Species:Homo sapiens
Sequence 2:NP_001261019.1 Gene:Strn-Mlck FlyBaseID:FBgn0265045 Length:8255 Species:Drosophila melanogaster

Alignment Length:922 Identity:198/923 (21%)
Similarity:315/923 (34%) Gaps:268/923 (29%)


Human    57 WLRFGFLLPI--FIQFGL-----YSPRIDPD--YVGRVRLQKGASLQIEGLRVEDQGWYECRVFF 112
            |...| |.||  |..|.|     |..|:.|.  |.....:|..:.||:.|:        ||.   
  Fly  6268 WRELG-LTPINSFDAFNLKPNVEYHFRVTPKNRYGWGPTVQTSSPLQVGGV--------ECL--- 6320

Human   113 LDQHIPEDDFANGSWVHLTVNSPPQFQETPPAVLEVQELEPVTLRCVARGSPLPHVTWKLRGKDL 177
                                   |:|.:..|...:.......||:|..||:|.|.|||...|..|
  Fly  6321 -----------------------PEFVKILPGQAKALLGSSFTLQCNMRGAPRPQVTWFKDGIQL 6362

Human   178 GQGQGQVQV-QNGT---LRIRRVERGSSGVYTCQASSTEGSATHATQLLVLGP------------ 226
            .....:|:: |.|:   |.|..|....||.|||:|::::|..:...:|.|:..            
  Fly  6363 SSSSERVKIRQIGSTCALTIATVSELDSGRYTCEATNSKGRVSTFARLQVVSDSRIYEADSRLKE 6427

Human   227 --------------PVIVVPPKNSTVNASQDVSLACHAEAYPANLTYSWFQDNINVFHISRLQPR 277
                          |:..:..::..|..:..|.|.|....||.. ...|::|: .:.|..|   :
  Fly  6428 IAHGRNVADVGDSLPIFTMRLRDRRVQVTYPVRLTCQIVGYPVP-EILWYKDD-ELIHTDR---K 6487

Human   278 VRILVDG---SLRLLATQPDDAGCYTCVPSNGLLHPPSASAYLTVLYPAQVTA-MPPETPLPIGM 338
            ..|..:|   :|.:.||..||:|.|||:..|.|   .|.|.:.|::....:.| :.|:..:|:..
  Fly  6488 HLISAEGQFFTLEIAATTLDDSGTYTCLARNEL---GSVSCHCTLVVDKGIRAYISPDFYVPLDP 6549

Human   339 PGVIR--CPVRANP-----PLLFVSWTKDGKALQLDKFPGWSQGTEG--SLIIALGNEDALGEYS 394
            ..:.|  ..:|.:.     |.:.|:|.::|..|:..:....:..:.|  .||||.......|.|.
  Fly  6550 FYIFREGSEIRLSTKVEAYPSVGVTWHRNGMRLRPSRRLTATLDSNGYVELIIAEATVRDAGIYV 6614

Human   395 CTPYNSLGTAGPSPVTRVLLK-------AP-------------------PAFIERPKEEYFQEVG 433
            |...|.:|..  ..:.||.::       ||                   |.|:.:|:.....| |
  Fly  6615 CVASNVVGKV--ETICRVAVEEAENKAVAPQRSLEIPSIKTDDLPYSKEPLFVVKPRSSEAYE-G 6676

Human   434 RELLIPCSAQGDPPPVVSW----------------TKVGRGLQGQAQVDSNSSLILRPLTK-EAH 481
            ..::|.|...|||.|.|.|                .::|.|.:.:.::         |..| :..
  Fly  6677 DNVIIFCEVVGDPKPEVVWLRDFLNPEYYKDAPHFRRIGDGPEYRLEI---------PSAKLDFT 6732

Human   482 GHWECSASN--AVARVATSTNVYV------------------LGTSPHVVTNVSVVALPKGANVS 526
            |.:...|||  ..|:...|..::.                  :.|.|..|.|:..:....|..:|
  Fly  6733 GTYSVIASNCHGEAKAVISLQIFAKDILNKSRMDKVHTRHGNIETLPRFVRNLRNLRCCDGDAIS 6797

Human   527 WEPGFDGGYLQRFSVWYTPLAKRP-DRMHHDWVSLAVPVGAAHLLVPGLQPHTQYQFSVLAQNKL 590
            .|...:.. .:.|.:|.......| ||   |:| ::.....|.|.:|.:.|..:.:::.:|:|.:
  Fly  6798 LECHVEAD-PEPFIIWEKDGHVMPSDR---DYV-MSFDGTKATLSIPRVYPEDEGEYTCVAKNSV 6857

Human   591 GSGPFSE-IVLSAPEGLPTTPAAPGLPPTEIPPPLSPPRGLVAVR-TPRGVLLHWDPPELVPKR- 652
            |....|. |::..||.          ....:...|:.|.||::.. |||..      |...|.| 
  Fly  6858 GRSLSSACIIVDVPEE----------KENMLSRQLARPSGLLSAHSTPRST------PRSTPARS 6906

Human   653 --------------LDGYVLEGRQGSQGWEVLDPAVAGTETELLVPGLIKDVLYEFRLVAFAGSF 703
                          |.| |.|.|:......:..|..      |.:|  ...|:.|...|.|..:.
  Fly  6907 FSPLRLSYRTSSIDLSG-VAERRRSDARNAITAPKF------LAIP--YNRVVEEGDSVRFQCAI 6962

Human   704 VSDPSNTANVSTSGLEVYPS---------------------------RTQLP---GLLPQPVLAG 738
            ...|:..|.....||.|.|:                           |..|.   |.:.......
  Fly  6963 SGHPTPWATWDKDGLIVTPTPRIAVKEIDDLRIIEIDEVTFDDAGLYRVTLENDFGRIEATARLD 7027

Human   739 VVGGVCFLGVAVLVSILAGCLLNRRRAARRRRKRLRQDPPLIFSPTGKSAAPSALGSGSPDSVAK 803
            |:....:.....:.|:.|..  :||.|...||         |..|:.......||.||       
  Fly  7028 VIRSSRYSKSPSVRSVRASS--SRRNAHLYRR---------IMGPSTAIGGRMALASG------- 7074

Human   804 LKLQGSPVPSLR 815
              .:||.|||:|
  Fly  7075 --YRGSSVPSVR 7084

Known Domains:


GeneSequenceDomainRegion External IDIdentity
IGSF9NP_001128522.1 Ig 24..132 CDD:299845 18/84 (21%)
IG_like 28..110 CDD:214653 18/62 (29%)
I-set 136..223 CDD:254352 29/91 (32%)
Ig 154..220 CDD:143165 25/70 (36%)
Ig_3 226..305 CDD:290638 22/108 (20%)
IG_like 233..319 CDD:214653 26/89 (29%)
Ig 341..404 CDD:299845 17/72 (24%)
IG_like 431..503 CDD:214653 20/91 (22%)
Ig 436..500 CDD:143165 18/83 (22%)
fn3 511..596 CDD:278470 19/86 (22%)
FN3 625..715 CDD:238020 23/106 (22%)
PDZ-binding. {ECO:0000250} 1177..1179
Strn-MlckNP_001261019.1 IG_like 51..127 CDD:214653
Ig <69..>112 CDD:299845
I-set 137..226 CDD:254352
I-set 235..314 CDD:254352
Ig_2 244..314 CDD:290606
I-set 438..513 CDD:254352
Ig 454..510 CDD:143165
I-set 537..626 CDD:254352
Ig 555..618 CDD:299845
I-set 636..713 CDD:254352
Ig 652..712 CDD:143165
SMC_N <2190..2854 CDD:280601
I-set 5300..5388 CDD:254352
IGc2 5313..5378 CDD:197706
IG 5412..5482 CDD:214652
IGc2 5413..5481 CDD:197706
I-set 5542..5627 CDD:254352
Ig 5556..5621 CDD:143165
Ig 5654..5721 CDD:143165
I-set 5784..5874 CDD:254352
IGc2 5797..5864 CDD:197706
I-set 5887..5970 CDD:254352
Ig 5902..5966 CDD:143165
I-set 5997..6086 CDD:254352
Ig 6026..6083 CDD:143165
I-set 6097..6187 CDD:254352
Ig 6114..6187 CDD:299845
FN3 6216..6310 CDD:238020 13/43 (30%)
I-set 6321..6412 CDD:254352 29/91 (32%)
Ig 6328..6412 CDD:299845 27/84 (32%)
I-set 6442..6531 CDD:254352 27/97 (28%)
Ig 6459..6528 CDD:143165 24/77 (31%)
I-set 6541..6632 CDD:254352 21/93 (23%)
IGc2 6555..6622 CDD:197706 15/67 (22%)
I-set 6662..6754 CDD:254352 23/102 (23%)
Ig 6679..6751 CDD:143165 17/81 (21%)
I-set 6779..6868 CDD:254352 22/94 (23%)
IGc2 6793..6858 CDD:197706 16/70 (23%)
Ig 6938..7022 CDD:299845 16/92 (17%)
I-set 6939..7028 CDD:254352 16/97 (16%)
IG 7075..7140 CDD:214652 6/11 (55%)
Ig 7075..7140 CDD:143165 6/11 (55%)
IG 7167..7239 CDD:214652
Ig 7173..7239 CDD:143165
Ig 7392..7475 CDD:299845
IG 7406..7475 CDD:214652
FN3 7489..7588 CDD:238020
S_TKc 7620..7876 CDD:214567
STKc_MLCK 7626..7876 CDD:271005
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.