DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: IGSF9 and Lac

Sequence 1:NP_001128522.1 Gene:IGSF9 HGNCID:18132 Length:1179 Species:Homo sapiens
Sequence 2:NP_523713.2 Gene:Lac FlyBaseID:FBgn0010238 Length:359 Species:Drosophila melanogaster

Alignment Length:296 Identity:75/297 (25%)
Similarity:113/297 (38%) Gaps:52/297 (18%)


Human    65 PIFIQFG--------LYSPRIDPDYVGRVRLQKGASLQIEGLRVEDQGWYECRVFFLDQHIPEDD 121
            |:|:..|        .:|.|.||:       .....|||:.::..|.|.|.|:|.....|....:
  Fly    69 PVFLSTGSTLVIKDSRFSLRYDPN-------SSTYKLQIKDIQETDAGTYTCQVVISTVHKVSAE 126

Human   122 FANGSWVHLTVNSPPQFQETPPAVLEVQELEPVTLRCVARGSPLPHVTWKLRGKDLGQGQGQVQV 186
                  |.|:|..||...:.....:...|...|.:.|.|.|.|.|.:||:.....:........|
  Fly   127 ------VKLSVR
RPPVISDNSTQSVVASEGSEVQMECYASGYPTPTITWRRENNAILPTDSATYV 185

Human   187 QNGTLRIRRVERGSSGVYTCQASS--TEGSATHATQLLVLGPPVIVVPPKNSTVNASQDVSLACH 249
            .| ||||:.|::...|.|.|.|.:  ::|...: ..:.|...|||.||..........|:.|.||
  Fly   186 GN-TLRIKSVKKEDRGTYYCVADNGVSKGDRRN-INVEV
EFAPVITVPRPRLGQALQYDMDLECH 248

Human   250 AEAYPANLTYSWFQDNINV-----FHISRLQPRVRILVDGSLRLLATQPDDAGCYTCVPSNGLLH 309
            .||||.. ...|.:|:|.:     :.||....... ..|.:||::..:....|.|.|..:|..  
  Fly   249 IEAYPPP-AIVWTKDDIQLANNQHYSISHFATADE-YTDSTLRVITVEKRQYGDYVCKATNRF-- 309

Human   310 PPSASAYLTVLYPAQVTAMPPETPLPIGMPGVIRCP 345
             ..|.|.:.:.          ||.:|:       ||
  Fly   310 -GEAEARVNL
F----------ETIIPV-------CP 327

Known Domains:


GeneSequenceDomainRegion External IDIdentity
IGSF9NP_001128522.1 Ig 24..132 CDD:299845 18/75 (24%)
IG_like 28..110 CDD:214653 14/53 (26%)
I-set 136..223 CDD:254352 22/89 (25%)
Ig 154..220 CDD:143165 20/68 (29%)
Ig_3 226..305 CDD:290638 24/84 (29%)
IG_like 233..319 CDD:214653 22/91 (24%)
Ig 341..404 CDD:299845 2/6 (33%)
IG_like 431..503 CDD:214653
Ig 436..500 CDD:143165
fn3 511..596 CDD:278470
FN3 625..715 CDD:238020
PDZ-binding. {ECO:0000250} 1177..1179
LacNP_523713.2 IG_like 36..131 CDD:214653 18/75 (24%)
V-set 43..132 CDD:284989 19/76 (25%)
IG_like 143..222 CDD:214653 21/81 (26%)
IGc2 149..211 CDD:197706 20/63 (32%)
I-set 227..318 CDD:254352 26/96 (27%)
IGc2 236..310 CDD:197706 20/79 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.