DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: IGSF9 and Dscam1

Sequence 1:NP_001128522.1 Gene:IGSF9 HGNCID:18132 Length:1179 Species:Homo sapiens
Sequence 2:NP_001246162.1 Gene:Dscam1 FlyBaseID:FBgn0033159 Length:2038 Species:Drosophila melanogaster

Alignment Length:803 Identity:186/804 (23%)
Similarity:283/804 (35%) Gaps:223/804 (28%)


Human    28 SVVGRAGESVV-----LGCDLLPPA-----GRP----------PLHVIEWLRFGFLLPIFIQFGL 72
            ||.|.:.|:|:     |...:.||.     |||          |:..:.|::.|..:      |.
  Fly   331 SVGGESVETVLTVTAPLSAKIDPPTQTVDFGRPAVFTCQYTGNPIKTVSWMKDGKAI------GH 389

Human    73 YSPRIDPDYVGRVRLQKGASLQIEGLRVEDQGWYECRVFFLDQHIPEDDFANGSWVHLTVN---S 134
            ..|                .|:||.::.||:|.|:|       .:..|..:..:...|.:.   .
  Fly   390 SEP----------------VLRIESVKKEDKGMYQC-------FVRNDQESAEASAELKLGGRFD 431

Human   135 PP----QFQETPPAVLEVQELEP---VTLRCVARGSPLPHVTWKLRGKDLGQGQ----GQVQVQN 188
            ||    .|||        :.:||   |.|:|||.|:|.|.::|:|.||.:....    ||....|
  Fly   432 PPVIRQAFQE--------ETMEPGPSVFLKCVAGGNPTPEISWELDGKKIANNDRYQVGQYVTVN 488

Human   189 GT----LRIRRVERGSSGVYTCQASSTEGSATHATQLLVLGPPVIVVPPKNSTVNASQDVSLACH 249
            |.    |.|..|.....|:|.|.|.|..|.|.|:.:|.|.|.|.|....|.:.| |.:.:.:.|.
  Fly   489 GDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKAIV-AGETLIVTCP 552

Human   250 AEAYPANLTYSWFQDNINVFHISRLQPRVRILVDGSLRLLATQPD-DAGCYTCVPSNGLLHPPSA 313
            ...||.: :..|.:|| ....|:|.|   ::..:|:|.:...:.: |...||||..|...:....
  Fly   553 VAGYPID-SIVWERDN-RALPINRKQ---KVFPNGTLIIENVERNSDQATYTCVAKNQEGYSARG 612

Human   314 SAYLTVLYPAQVTAMPPETPLPIGMPGVIRCPVRANPPLLFVSWTKDGKALQLDKFPGWSQ---- 374
            |..:.|:...|:.....|..:.:|....:.|.::.....:.|.|:.:..|...    |:.|    
  Fly   613 SLEVQVMVLPQIVPFAYEDLINMGDSIDLFCQIQKGDRPIKVHWSFERSAGDY----GFDQVQPQ 673

Human   375 ------GTEGSLI-IALGNEDALGEYSCTPYNSLGTAGPSPVTRVLLKAPPAFIERPKEEYFQEV 432
                  ..:.|:| |...:....|..:|...|..||...|  ..:.:..||.:|..|.::.|.: 
  Fly   674 MRTNRISEKTSMISIPSASPAHTGRDTCIASNKAGTTTYS--VDLTVNVPPRWILEPTDKAFAQ- 735

Human   433 GRELLIPCSAQGDPPPVVSWTK-VG---------------RGLQGQAQVDSNSSLILRPLTKEAH 481
            |.:..:.|.|.|.|.|.|:|.| ||               |..:|...||:        :.|...
  Fly   736 GSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRVEEGTLHVDN--------IQKTNE 792

Human   482 GHWECSASNAVARVATSTNVYVLGTSPHVVTNVSVVALP-----------------------KGA 523
            |::.|.|.|.:            |:....|..:||.|.|                       ||.
  Fly   793 GYYLCEAINGI------------GSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAKGE 845

Human   524 ----------NVSWEPGFDGGYLQRFSVWYTPL-----AKRPDRMHHDWVSLAVPVGAAHLLVPG 573
                      |:..:|..|..|..|..:..|.:     .||.:|                     
  Fly   846 KPIGILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTER--------------------- 889

Human   574 LQPHTQYQFSVLAQNKLGS--GPFSEIVLSAPEGLPTTPAAPGLPPTEIPPPLSPPRGLVAVRTP 636
               .....|:.:|.|..||  ...:.||...|               |:|..|.     |..::.
  Fly   890 ---SDSALFTCVATNAFGSDDASINMIVQEVP---------------EMPYALK-----VLDKSG 931

Human   637 RGVLLHWDPPELVPKRLDGYVLEGRQGSQGWEVLDPA-VAGTETELLVPGLIKDVLYEFRLVAFA 700
            |.|.|.|..|......||.|::|.::....|..:|.. |.|..||..|..|.....|..|:||..
  Fly   932 RSVQLSWAQPYDGNSPLDRYIIEFKRSRASWSEIDRVIVPGHTTEAQVQKLSPATTYNIRIVAEN 996

Human   701 GSFVSDPSNTANVSTSGLEVYPS 723
            ....|..|....:.|:  |..||
  Fly   997 AIGTSQSSEAVTIITA--EEAPS 1017

Known Domains:


GeneSequenceDomainRegion External IDIdentity
IGSF9NP_001128522.1 Ig 24..132 CDD:299845 26/124 (21%)
IG_like 28..110 CDD:214653 24/102 (24%)
I-set 136..223 CDD:254352 34/102 (33%)
Ig 154..220 CDD:143165 27/74 (36%)
Ig_3 226..305 CDD:290638 21/80 (26%)
IG_like 233..319 CDD:214653 21/87 (24%)
Ig 341..404 CDD:299845 14/74 (19%)
IG_like 431..503 CDD:214653 20/88 (23%)
Ig 436..500 CDD:143165 19/80 (24%)
fn3 511..596 CDD:278470 21/125 (17%)
FN3 625..715 CDD:238020 24/91 (26%)
PDZ-binding. {ECO:0000250} 1177..1179
Dscam1NP_001246162.1 Ig 38..130 CDD:299845
IG 57..133 CDD:214652
IG_like 267..343 CDD:214653 5/12 (42%)
Ig 269..340 CDD:143165 4/9 (44%)
IG_like 353..425 CDD:214653 20/101 (20%)
IGc2 361..413 CDD:197706 16/81 (20%)
I-set 433..527 CDD:254352 34/102 (33%)
IGc2 446..517 CDD:197706 25/71 (35%)
I-set 533..618 CDD:254352 22/91 (24%)
IGc2 544..607 CDD:197706 17/68 (25%)
Ig 641..714 CDD:143165 15/79 (19%)
IGc2 735..804 CDD:197706 20/90 (22%)
I-set 819..914 CDD:254352 18/119 (15%)
Ig 833..921 CDD:299845 20/127 (16%)
FN3 918..1011 CDD:238020 28/113 (25%)
FN3 1018..1116 CDD:238020 186/804 (23%)
FN3 1124..1217 CDD:238020
FN3 1222..1312 CDD:238020
Ig 1339..1406 CDD:299845
FN3 1409..1499 CDD:238020
FN3 1504..1584 CDD:238020
Dscam_C 1890..2008 CDD:289151
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.