DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: IGSF9 and dpr19

Sequence 1:NP_001128522.1 Gene:IGSF9 HGNCID:18132 Length:1179 Species:Homo sapiens
Sequence 2:NP_001260336.1 Gene:dpr19 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster

Alignment Length:378 Identity:84/379 (22%)
Similarity:130/379 (34%) Gaps:125/379 (33%)


Human     3 WCLGLAVLSLVISQGADGRGKPEVVS--------------------VVGRAGESVVLGC--DLLP 45
            |.|.|:...|::|......||  :.|                    |:.:.|...:|.|  .:..
  Fly     6 WHLHLSCFLLLLSSTFSDVGK--ITSSQNHFGNTLQSQFNTKNNTRVIAQKGGLAILPCVVKVNS 68

Human    46 PAGRPPLHVIEWL-RFGFLLPIFIQFGLYSPRIDPDY-VGRVRLQKGASLQIEGLRVEDQGWYEC 108
            ||      .:.|: |..|.|   :..||.:...|..: |...|.....||:|:.:|.||:|:|||
  Fly    69 PA------TVSWIRRKDFQL---LTVGLSTHSSDKRFLVEHTRHMGHWSLRIKAVREEDRGFYEC 124

Human   109 RV-------FFLDQHIPEDDFANGSWVHLTVNSPPQFQETPPAVLEVQELEPVTLRC-VARGSPL 165
            ::       ..::..|.|        ....::|.|:        |.:.|...:.|.| :.|.:..
  Fly   125 QLSIYPTQSIVIELKIVE--------AVAEISSAPE--------LHIDETSTLRLECKLKRATEN 173

Human   166 P-HVTW----KLRGKDLGQGQ------GQVQVQNGTL---------RIRRVERGSSGVYTCQASS 210
            | .|.|    |:...| .||.      ||...|:|..         |.......|:||......|
  Fly   174 PAFVFWYHDSKMINYD-SQGGFVVTSIGQSNPQSGQFYRSSPANKSRATMPMESSNGVLNSLLGS 237

Human   211 TEGSATHATQLLVLGPPVIVVPPKNSTVNASQDVSLACHAEAYPANLTYSWFQDNINVFHISRLQ 275
            ::          .:..|...||  :||...:|.     |..||..|       .:::|..:.::.
  Fly   238 SD----------AIKAPAANVP--SSTPYMTQQ-----HQSAYLLN-------PSVSVLTVKQVN 278

Human   276 PRVRILVDGSLRLLATQPDDAGCYTCVPSNGLLHPPSASAYLTVLYPAQVTAM 328
            .|                 .||.|||.|||.  .|.|.:.:  ||...:..||
  Fly   279 FR-----------------HAGNYTCAPSNA--RPASITVH--VLRGEKTAAM 310

Known Domains:


GeneSequenceDomainRegion External IDIdentity
IGSF9NP_001128522.1 Ig 24..132 CDD:299845 28/139 (20%)
IG_like 28..110 CDD:214653 26/106 (25%)
I-set 136..223 CDD:254352 22/108 (20%)
Ig 154..220 CDD:143165 19/87 (22%)
Ig_3 226..305 CDD:290638 19/79 (24%)
IG_like 233..319 CDD:214653 19/86 (22%)
Ig 341..404 CDD:299845
IG_like 431..503 CDD:214653
Ig 436..500 CDD:143165
fn3 511..596 CDD:278470
FN3 625..715 CDD:238020
PDZ-binding. {ECO:0000250} 1177..1179
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 25/86 (29%)
IGc2 55..125 CDD:197706 24/79 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.