DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IGSF9 and DIP-zeta

DIOPT Version :9

Sequence 1:NP_001128522.1 Gene:IGSF9 / 57549 HGNCID:18132 Length:1179 Species:Homo sapiens
Sequence 2:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster


Alignment Length:339 Identity:80/339 - (23%)
Similarity:147/339 - (43%) Gaps:59/339 - (17%)


- Green bases have known domain annotations that are detailed below.


Human    10 LSLVISQGADGRGKPE----VVSVVGRAGESVVLGCDLLPPAGRPPLHVIEWLRF--GFLLPIFI 68
            |::|:.:       ||    :.:|...||.:|.|||.:.....    :.:.|:.|  ..:|.:..
  Fly   106 LNIVVEE-------PEFTEYIENVTVPAGRNVKLGCSVKNLGS----YKVAWMHFEQSAILTVHN 159

Human    69 QFGLYSPRIDPDYVGRVRLQKGASLQIEGLRVEDQGWYECRVFFLDQHIPEDDFANGSWVHLTVN 133
            .....:|||...:....| .:...|.|..:..||:|.|.|::..:.        |...:.:|.|.
  Fly   160 HVITRNPRISVTHDKHDR-HRTWYLHINNVHEEDRGRYMCQINTVT--------AKTQFGYLNVV 215

Human   134 SPPQFQET-PPAVLEVQELEPVTLRCVARGSPLPHVTWKLRGKD------LGQGQGQVQVQNGTL 191
            .||...:: ..:.:.|:|...::|||.|.|||.|.:.||   :|      :.:.....:.:..||
  Fly   216 VPPNIDDSLSSSDVIVREGANISLRCRASGSPRPIIKWK---RDDNSRIAINKNHIVNEWEGDTL 277

Human   192 RIRRVERGSSGVYTCQASS-TEGSATHATQLLVLGPPVIVVPPKNSTVNASQ--DVSLACHAEAY 253
            .|.|:.|...|.|.|.||: ...:.:...::.|..||::::|  :..|.|.:  :|::.|..||:
  Fly   278 EITRISRLDMGAYLCIASNGVPPTVSKRIKVSVDFPPMLLIP--HQLVGAPEGFNVTIECFTEAH 340

Human   254 PANLTYSWFQDNINVFHIS---RLQPRVRI---LVDGSLRLLATQPDDAGCYTCVPSN------G 306
            |.:|.| |.:....:.|.|   :::..|.:   .....|.::.....|.|.|.||..|      |
  Fly   341 PTSLNY-WTRGEGPIIHDSHKYKVEATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDG 404

Human   307 LL-----HPPSASA 315
            ::     :||:.::
  Fly   405 IIRLYVSYPPTTAS 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IGSF9NP_001128522.1 Ig 24..132 CDD:299845 25/113 (22%)
IG_like 28..110 CDD:214653 21/83 (25%)
I-set 136..223 CDD:254352 24/94 (26%)
Ig 154..220 CDD:143165 21/72 (29%)
Ig_3 226..305 CDD:290638 22/86 (26%)
IG_like 233..319 CDD:214653 23/102 (23%)
Ig 341..404 CDD:299845
IG_like 431..503 CDD:214653
Ig 436..500 CDD:143165
fn3 511..596 CDD:278470
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 606..626
FN3 625..715 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 767..919
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 940..988
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1015..1079
PDZ-binding. /evidence=ECO:0000250 1177..1179
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 24/108 (22%)
Ig 130..200 CDD:143165 18/74 (24%)
I-set 226..310 CDD:254352 23/86 (27%)
IGc2 233..298 CDD:197706 22/67 (33%)
Ig 313..410 CDD:299845 24/99 (24%)
IG_like 325..410 CDD:214653 20/85 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.