DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: IGSF9 and DIP-iota

Sequence 1:NP_001128522.1 Gene:IGSF9 HGNCID:18132 Length:1179 Species:Homo sapiens
Sequence 2:NP_001097100.1 Gene:DIP-iota FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster

Alignment Length:237 Identity:61/238 (26%)
Similarity:100/238 (42%) Gaps:44/238 (18%)


Human    93 LQIEGLRVEDQGWYECRVFFLDQHIPEDDFANGSWVHLTVNSPP---QFQETPPAVLEVQELEPV 154
            |:|..::..|:|||.|::        ..|.......:|.|..||   .:|.:...|....  :.|
  Fly    98 LKIRDVQESDRGWYMCQI--------NTDPMKSQMG
YLDVVVPPDIVDYQTSQDVVRSTG--QNV 152

Human   155 TLRCVARGSPLPHVTWK-------LRGKDLGQGQGQV-QVQNGTLRIRRVERGSSGVYTCQASS- 210
            ||.|.|.|.|:|.:||:       |...|   |..:| .|:...|.:.:|:|...|.|.|.||: 
  Fly   153 TLTCSATGVPMPTITWRREEATPILISDD---GDREVFSVEGQNLTLWQVQRSHMGAYLCIASNG 214

Human   211 TEGSATHATQLLVLGPPVIVVPPKNSTVNASQDVSLACHAEAYPANLTYSWFQD----------N 265
            ...:.:....|:|...|.|........|...|.::|.|..|:.||::.: |.:|          :
  Fly   215 VPPTVSKRVMLVV
NFAPTIWTRYDTIYVGLGQKLTLECITESQPASVNF-WLRDSQLLQGGSYES 278

Human   266 INVFHISRLQPRVRILVDGSLRLLATQPDDAGCYTCVPSNGL 307
            ::|.|:.|:..|:      :||.:..:  |.|.|.|...|.:
  Fly   279 VSVDHVFRIVMRI------TLRPITKR--DFGEYICRAKNAM 312

Known Domains:


GeneSequenceDomainRegion External IDIdentity
IGSF9NP_001128522.1 Ig 24..132 CDD:299845 9/39 (23%)
IG_like 28..110 CDD:214653 7/17 (41%)
I-set 136..223 CDD:254352 27/99 (27%)
Ig 154..220 CDD:143165 23/75 (31%)
Ig_3 226..305 CDD:290638 21/89 (24%)
IG_like 233..319 CDD:214653 20/86 (23%)
Ig 341..404 CDD:299845
IG_like 431..503 CDD:214653
Ig 436..500 CDD:143165
fn3 511..596 CDD:278470
FN3 625..715 CDD:238020
PDZ-binding. {ECO:0000250} 1177..1179
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 8/35 (23%)
Ig 39..122 CDD:299845 8/32 (25%)
Ig 132..213 CDD:299845 27/86 (31%)
IG_like 141..227 CDD:214653 25/91 (27%)
IG_like 239..322 CDD:214653 20/84 (24%)
IGc2 245..313 CDD:197706 19/78 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.