DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: IGSF9 and DIP-theta

Sequence 1:NP_001128522.1 Gene:IGSF9 HGNCID:18132 Length:1179 Species:Homo sapiens
Sequence 2:NP_723103.1 Gene:DIP-theta FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster

Alignment Length:260 Identity:72/261 (28%)
Similarity:116/261 (44%) Gaps:38/261 (15%)


Human    93 LQIEGLRVEDQGWYECRVFFLDQHIPEDDFANGSWVHLTVNSPPQFQETPPAV-LEVQELEPVTL 156
            |:|..::..|:|||.|::        ..|.......:|.|..||...:.|.:. :.::|...|||
  Fly   197 LRIRDVKESDKGWYMCQI--------NTDPMKSQVGYLDVVV
PPDILDYPTSTDMVIREGSNVTL 253

Human   157 RCVARGSPLPHVTWKLRGKD---LGQGQGQVQVQNGTLRIRRVERGSSGVYTCQASS-TEGSATH 217
            :|.|.|||.|.:||:..|.:   |..|...|......|.|.:|.|.:.|.|.|.||: ...:.:.
  Fly   254 KCAATGSPTPTITWRREGGELIPLPNGAEAVAYNGSFLTIAKVNRLNMGAYLCIASNGIPPTVSK 318

Human   218 ATQLLVLGPPVIVVPPKNSTVNA--SQDVSLACHAEAYPANLTYSWFQDNINVFHISRLQPRV-- 278
            ...|:|..||:|.:  :|..|.|  :|:::|.|.:||||.::.| |.:::..:....|..|..  
  Fly   319 RVMLIV
HFPPMIWI--QNQLVGAALTQNITLECQSEAYPKSINY-WMKNDTIIVPGERFVPETFE 380

Human   279 ---RILVDGSLRLLATQPD--DAGCYTCVPSNG---------LLHPPSASAYLTVLYPAQVTAMP 329
               :|    ::||...:.|  |.|.|.||..|.         |.|.|..:...|:.....:..:|
  Fly   381 SGYKI----TMRLTIYEVDIQDFGAYRCVAKNSLGDTDGAIKLYHIPQTTTMTTMAPTVSINTVP 441

Human   330  329
              Fly   442  441

Known Domains:


GeneSequenceDomainRegion External IDIdentity
IGSF9NP_001128522.1 Ig 24..132 CDD:299845 9/39 (23%)
IG_like 28..110 CDD:214653 7/17 (41%)
I-set 136..223 CDD:254352 28/92 (30%)
Ig 154..220 CDD:143165 24/70 (34%)
Ig_3 226..305 CDD:290638 26/88 (30%)
IG_like 233..319 CDD:214653 28/104 (27%)
Ig 341..404 CDD:299845
IG_like 431..503 CDD:214653
Ig 436..500 CDD:143165
fn3 511..596 CDD:278470
FN3 625..715 CDD:238020
PDZ-binding. {ECO:0000250} 1177..1179
DIP-thetaNP_723103.1 Ig 137..230 CDD:299845 10/41 (24%)
IG_like 137..230 CDD:214653 10/41 (24%)
IG_like 240..324 CDD:214653 26/84 (31%)
IGc2 247..310 CDD:197706 25/63 (40%)
Ig 327..419 CDD:299845 27/99 (27%)
IG_like 343..420 CDD:214653 22/82 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.