DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: IGSF9 and DIP-eta

Sequence 1:NP_001128522.1 Gene:IGSF9 HGNCID:18132 Length:1179 Species:Homo sapiens
Sequence 2:NP_001188701.2 Gene:DIP-eta FlyBaseID:FBgn0031725 Length:450 Species:Drosophila melanogaster

Alignment Length:358 Identity:90/359 (25%)
Similarity:151/359 (42%) Gaps:72/359 (20%)


Human     5 LGLAVLSLVISQG-------------ADGRGKPEVVSVVGRAGESVVLGC---DLLPPAGRPPLH 53
            |.:.:|.:::||.             .|.:....:|::....|....|.|   ||.|       :
  Fly    15 LSVILLLILMSQQCYPQRVEVPAEVIVDPKFSSPIVNMTAPVGRDAFLTCVVQDLGP-------Y 72

Human    54 VIEWLRFGFLLPIFIQFGLYSPRIDPDYVGRVRLQ-KGASLQIEGLRVEDQGWYECRVFFLDQHI 117
            .:.|||......:.||..:.:..   ..:|....: |..:::|:.::..|:|||.|::       
  Fly    73 KVAWLRVDTQTILTIQNHVITKN---QRIGIANSEHKTWTMRIKDIKESDKGWYMCQI------- 127

Human   118 PEDDFANGSWVHLTVNSPPQFQETPPAV-LEVQELEPVTLRCVARGSPLPHVTWKLRGK---DLG 178
             ..|.......:|.|..||...:.|.:. :.|:|...|||:|.|.|||.|.:||:....   :|.
  Fly   128 -NTDPMKSQMGYLDVVVPPDILDYPTSTDMVVREGSNVTLKCAATGSPEPTITWRRESGVPIELA 191

Human   179 QGQGQVQVQNGTLRIRRVERGSSGVYTCQASS-TEGSATHATQLLVLGPPVIVVPPKNSTVNA-- 240
            .|:..:.::...|.|..|.|...|.|.|.||: ...|.:....|:|..||:|.|  :|..:.|  
  Fly   192 TGEEVMSIEGTDLVIPNVRRHHMGAYLCIASNGVPPSVSKRITLVVHFPPMITV--QNQLIGAVE 254

Human   241 SQDVSLACHAEAYPANLTYSWFQD-----------NINVFHISRLQPRVRILVDGSLRLLATQPD 294
            .:.|:|.|.:||||.::.| |.::           :.||..|...:..:|:.::.     .||. 
  Fly   255 GKGVTLDCESEAYPKSINY-WTRERGEIVPPGGKYSANVTEIGGYRNSMRLHINP-----LTQA- 312

Human   295 DAGCYTCVPSNGL--------LH--PPSASAYL 317
            :.|.|.||..|.|        |:  ||:|..|:
  Fly   313 EFGSYRCVAKNSLGDTDGTIKLYRIPPNAVNYV 345

Known Domains:


GeneSequenceDomainRegion External IDIdentity
IGSF9NP_001128522.1 Ig 24..132 CDD:299845 22/112 (20%)
IG_like 28..110 CDD:214653 19/86 (22%)
I-set 136..223 CDD:254352 28/92 (30%)
Ig 154..220 CDD:143165 23/70 (33%)
Ig_3 226..305 CDD:290638 25/92 (27%)
IG_like 233..319 CDD:214653 28/109 (26%)
Ig 341..404 CDD:299845
IG_like 431..503 CDD:214653
Ig 436..500 CDD:143165
fn3 511..596 CDD:278470
FN3 625..715 CDD:238020
PDZ-binding. {ECO:0000250} 1177..1179
DIP-etaNP_001188701.2 Ig 51..141 CDD:299845 21/108 (19%)
IG_like 51..137 CDD:214653 20/104 (19%)
IG_like 153..237 CDD:214653 26/84 (31%)
Ig 161..224 CDD:299845 22/63 (35%)
IG_like 252..335 CDD:214653 23/90 (26%)
Ig 258..333 CDD:143165 21/82 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.