DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: IGSF9 and fipi

Sequence 1:NP_001128522.1 Gene:IGSF9 HGNCID:18132 Length:1179 Species:Homo sapiens
Sequence 2:NP_787975.1 Gene:fipi FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster

Alignment Length:598 Identity:118/599 (20%)
Similarity:184/599 (31%) Gaps:239/599 (40%)


Human    24 PEVVSVVGRAGESVVLGCDLLPPAGRPPLHVIEWLRFGFLLPIFIQFGLYSPR--IDPDYVGRVR 86
            |...|||....||:::.|  ..|..:..||   |               .||:  |..::.||:.
  Fly    29 PAEHSVVRYTNESLIVQC--RSPDPKVELH---W---------------KSPKGEIIREHKGRIH 73

Human    87 LQKGASLQIE----GLRVEDQGWYECRVFFLDQHIPEDDFANGSWVH-----LTVNSPPQFQETP 142
            :::.::.|::    .:.:.|:|.:.|            :.|:|| :|     |.|.....|.|. 
  Fly    74 IEQTSTEQLKIVFAHIALADKGNWSC------------EAADGS-LHSKSFDLIVYQKITFTEN- 124

Human   143 PAVLEVQELEPVTLRCVARGSPLPHVTWKLRGKDLGQG---QGQVQVQNGTLRIRRVERGSSGVY 204
            ..|:.|:|.|..|:.|..:|.|.|:|||...|:.:..|   ..:.::....|.|.:|.:..:|.|
  Fly   125 ATVMTVKEGEKATILCEVKGEPQPNVTWHFNGQPISAGAADDSKFRILADGLLINKVTQNDTGEY 189

Human   205 TCQASSTEGSATHATQLLVL----GPPVIVVPP----KNSTVNASQDVSLACHAEAY-PANLTYS 260
            .|:|......|:...:..||    ..|:....|    |.:.:|.:  .:|.|.|.|. |||.|  
  Fly   190 ACRAYQVNSIASDMQERTVLMKIEHKPIWSKTPFVSLKYAYINGT--ATLMCEALAEPPANFT-- 250

Human   261 WFQDNINVFHISRLQPRVRILVDGSLRLLATQPDDAGCYTCVPSNGLLHPPSASAYLTVLYPAQV 325
            |::.: |..|                                 ||..|:...:.:|         
  Fly   251 WYRKH-NKLH---------------------------------SNNRLYTIQSDSY--------- 272

Human   326 TAMPPETPLPIGMPGVIRCPVRANPPLLFVSWTKDGKALQLDKFPGWSQGTEGSLIIALGNEDAL 390
                                                          ||     ||.|.:.|..|.
  Fly   273 ----------------------------------------------WS-----SLTIHVLNTSAF 286

Human   391 GEYSCTPYNSLGTAGPSPVTRVLLKAPPAFIERPKEEYFQEVGRELLIPCSAQGDPPPVVSWTKV 455
            ..|.|...|.|||                 |||...              ..||:.||       
  Fly   287 DNYRCRARNDLGT-----------------IERTTR--------------LEQGEKPP------- 313

Human   456 GRGLQGQAQVDSNSSLILRPLTKEAHGHWECSASNAVARVATSTNVYVLGTSPHVVTNVSVVALP 520
                                           |.:|...|...|....|:.::|....:     .|
  Fly   314 -------------------------------SPANFQLRGFNSNTFDVVLSAPRGPPD-----SP 342

Human   521 KGANVSWEPGFDGGYLQRFSVWYTPLAKRPDRMHHDWVSLAVPVGAAHLLVPGLQPHTQYQFSVL 585
            .|.|     ||...|:.... :.|...|..:....|:   |...||..||. .|:|.|.|.....
  Fly   343 MGVN-----GFRIEYMTEME-FKTDAGKWTNARRKDY---AFEEGATFLLT-NLEPDTVYLVRAA 397

Human   586 AQNKLGSGPFSEI 598
            ::|..|...|:::
  Fly   398 SRNLAGFSDFTKV 410

Known Domains:


GeneSequenceDomainRegion External IDIdentity
IGSF9NP_001128522.1 Ig 24..132 CDD:299845 25/119 (21%)
IG_like 28..110 CDD:214653 19/88 (22%)
I-set 136..223 CDD:254352 24/90 (27%)
Ig 154..220 CDD:143165 18/69 (26%)
Ig_3 226..305 CDD:290638 16/84 (19%)
IG_like 233..319 CDD:214653 18/91 (20%)
Ig 341..404 CDD:299845 13/63 (21%)
IG_like 431..503 CDD:214653 8/72 (11%)
Ig 436..500 CDD:143165 8/64 (13%)
fn3 511..596 CDD:278470 21/85 (25%)
FN3 625..715 CDD:238020
PDZ-binding. {ECO:0000250} 1177..1179
fipiNP_787975.1 IG_like 33..115 CDD:214653 24/115 (21%)
I-set 128..202 CDD:254352 21/74 (28%)
Ig 133..>193 CDD:299845 17/60 (28%)
IG_like 228..307 CDD:214653 32/208 (15%)
Ig 235..305 CDD:143165 31/183 (17%)
FN3 312..415 CDD:238020 29/153 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.