DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: IGSF9 and bdl

Sequence 1:NP_001128522.1 Gene:IGSF9 HGNCID:18132 Length:1179 Species:Homo sapiens
Sequence 2:NP_608822.1 Gene:bdl FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster

Alignment Length:842 Identity:216/843 (26%)
Similarity:317/843 (38%) Gaps:204/843 (24%)


Human     7 LAVLSLV----ISQGADGRGKPEVVSVVGRAGESVVLGCDLLPPAGRPPLHVIEWLRFGFLLPIF 67
            ||:|:::    ||..:..|......::..:.|..||..|.:..|...|..:::.|.:....:   
  Fly    17 LALLAIILLMNISCTSAARDHRRQTNLEAKVGSHVVFNCYIDFPFDAPIPYLVHWTKDNKKI--- 78

Human    68 IQFGLYSPRIDPD--YVGRVRLQKG------ASLQIEGLRVEDQGWYECRVFFLDQHIPEDDFAN 124
              |..|.......  :.||:.|.:.      ||:.:..:|..|||||.|:|          .|.|
  Fly    79 --FTWYEQETSTSELFNGRLHLVENHPEFGRASVNLTAIRESDQGWYHCQV----------SFPN 131

Human   125 GSWVHLTVNSPPQFQETPPAVLEVQELEPVTLRCVARGSPLPHVTWKLRGKDLGQGQGQVQVQNG 189
            .|                |:|.                                        .||
  Fly   132 RS----------------PSVR----------------------------------------NNG 140

Human   190 TLRIRRVERGSSGVYTCQASSTEGSATHATQLLVLGPPVIVVPPKNSTVNASQDVSLACHAEAYP 254
            |                           |..|.|.|..:|.:||.|.|:...|.....| ...:|
  Fly   141 T---------------------------AYHLAVQGGSLIRIPPVNQTIREGQTAFFHC-VMKHP 177

Human   255 ANLTYSWFQDNINVFHISRLQPRVRILVDGSLRLLATQPDDAGCYTCVPSNGLLHPPSASAYLTV 319
            .|...||::|.:.:..:..|..|..:..||||.:..|...|.|.|.|...|......:|.|:|.:
  Fly   178 ENSQASWYKDGVLLQEVQDLVRRFYMGPDGSLSIDPTMMSDLGEYECKVRNSDGELQTAKAFLNI 242

Human   320 LYPAQVTAMPPETPLPIGMPGVIRCPVRANPPLLFVSWTKDGKALQLDKFPGWSQGTEGSLIIAL 384
            .|.|:|...|||..||.|.|.|:.|..||||||..:.|.|||........||......|||..|.
  Fly   243 QYKAKVIYAPPEVFLPYGQPAVLDCHFRANPPLKNLRWEKDGLLFDSYNVPGVFYKMNGSLFFAK 307

Human   385 GNEDALGEYSCTPYNSLGTAGPSPVTRVLLKAPPAFIERPKEEYFQEVGRELLIPCSA---QGDP 446
            .:|:..|.|:|||||.|||.|||||..|::..||.|...||..|.|::|....:||.|   .|:.
  Fly   308 VDENHAGSYTCTPYNDLGTDGPSPVISVIVLRPPIFSVTPKAIYIQKLGEAAELPCEAIDRDGNN 372

Human   447 PPVVSW-TKVGRGLQGQAQVDSNSSLILRPLTKEAHGHWECSASNAVARVATSTNVYVLGTSPHV 510
            .|.:.| .|.|:.|.......|..:|.:..|.:...|.:||||:|..|.:.....:.:...:|..
  Fly   373 RPSIIWGRKDGQPLPADRFSLSGGNLTITGLVEGDRGIYECSATNEAATITAEAELMIENIAPRA 437

Human   511 VTNVSVVALPKGANVSWEPGFDGGYLQ---RFSVWYTPLAKRPDRMHHDWVSLAV-PVGAAHLLV 571
            ..|::..:......:.|:|    |||:   .::|||. |.:.|     :|.:|.| ........|
  Fly   438 PYNLTANSTETCITIRWQP----GYLRPNLEYTVWYR-LMEAP-----EWRTLRVLDKKVMEATV 492

Human   572 PGLQPHTQYQFSVLAQNKLGSGPFSE----IVLSAP--------------EGLPTTPAAPGLPPT 618
            ..|||..:|:|.||:|:|.|.|.||:    ..|.:|              .|..|.||.      
  Fly   493 QHLQPGKEYEFMVLSQDKYGDGMFSKQFRFQTLPSPIRADDFDAQQLQHDLGQVTAPAG------ 551

Human   619 EIPPPLSPPRGLVAVRTPRGVLLHWDPPELVPKRLDGYVLEGRQG-----SQGWEVLDPAVAG-T 677
                .|..|..|.|:...:|.||||:.|           ::|.:|     .:.|:..:..:.| .
  Fly   552 ----GLGAPWNLTAISNQQGWLLHWEHP-----------VQGLEGLRLYAVRWWKEPEHFLIGHA 601

Human   678 ET---ELLVPGLIKDVLYEFRLVAFAGSFVSDPSNTANVSTSGLEVYPSRTQLPGLLPQ-PVLAG 738
            ||   ...:..|.:|.|::.:::|              |.|...:..||...|..:..| .|.|.
  Fly   602 ETFDNYYQLRHLKEDTLFKVQVLA--------------VGTETQQSVPSHELLIDVPSQRKVRAL 652

Human   739 VVGGVCFLGVAVLVSILAGCLLNRRRAARRRRKRLRQDPPLIFSPTGKSAAPSALGSGSPDS 800
            ::|.  .:||..|:..|...|..:|...|.          |....:..|.......||..||
  Fly   653 IIGS--SVGVIFLLCALCAFLYVKRSCLRH----------LFAKDSSASEDEDTAESGDCDS 702

Known Domains:


GeneSequenceDomainRegion External IDIdentity
IGSF9NP_001128522.1 Ig 24..132 CDD:299845 25/116 (22%)
IG_like 28..110 CDD:214653 21/90 (23%)
I-set 136..223 CDD:254352 7/87 (8%)
Ig 154..220 CDD:143165 4/66 (6%)
Ig_3 226..305 CDD:290638 23/79 (29%)
IG_like 233..319 CDD:214653 25/86 (29%)
Ig 341..404 CDD:299845 29/63 (46%)
IG_like 431..503 CDD:214653 20/76 (26%)
Ig 436..500 CDD:143165 19/68 (28%)
fn3 511..596 CDD:278470 27/89 (30%)
FN3 625..715 CDD:238020 20/99 (20%)
PDZ-binding. {ECO:0000250} 1177..1179
bdlNP_608822.1 IG_like 42..128 CDD:214653 22/101 (22%)
Ig 43..131 CDD:299845 23/103 (22%)
I-set 153..242 CDD:254352 27/90 (30%)
Ig 157..242 CDD:299845 25/86 (29%)
Ig_2 252..337 CDD:290606 42/85 (49%)
IG_like 260..327 CDD:214653 31/67 (46%)
I-set 341..428 CDD:254352 26/87 (30%)
IGc2 356..419 CDD:197706 19/63 (30%)
FN3 435..524 CDD:238020 29/99 (29%)
FN3 554..636 CDD:238020 22/107 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D151368at33208
OrthoFinder 1 1.000 FOG0001378
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10075
Phylome 1 0.910 0.947 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.