DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: IGSF9 and dpr2

Sequence 1:NP_001128522.1 Gene:IGSF9 HGNCID:18132 Length:1179 Species:Homo sapiens
Sequence 2:NP_001014480.4 Gene:dpr2 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster

Alignment Length:302 Identity:70/303 (23%)
Similarity:110/303 (36%) Gaps:89/303 (29%)


Human    77 IDPDY-----VGRVRLQKGASLQIEGLRVEDQGWYECRVFFLDQHIPEDDFANGSWVHLTVNSPP 136
            ||.||     |.|...|.|.|:..| ...|:|.             ||:          |...||
  Fly    66 IDNDYVYIASVNRKFPQFGNSIDDE-REAEEQP-------------PEE----------TTYPPP 106

Human   137 QFQETPPAVLEVQELEPVTLRCVARGSPLPHVTWKLRGKDLG---------QGQGQVQV------ 186
            .|....|..:..:......:.|.........|:| :|.:||.         ....:.:|      
  Fly   107 VFDFGMPRNITTRTGHTAAINCRVDNLGDKSVSW-IRKRDLHILTAGILTYTSDERFKVVRTADS 170

Human   187 QNGTLRIRRVERGSSGVYTCQASSTEGSATHATQL-LVLGPP---VIVVPPKNSTVNASQDVSLA 247
            ::.||.::..:...||:|.||. :||...:.|.:| :::.||   .|:..|.:..|.....|:|.
  Fly   171 KDWTLHVKYAQPRDSGIYECQV-NTEPKISMAFRLNVIVTPPDAKAIIAGPTDLYVKVGSSVTLT 234

Human   248 CHAEAYPANLTYS-----WFQD--------------NINVFHIS-------RLQPRVRILVDGSL 286
            ||.: .||.....     |::.              .|::..||       :||.|:||   .:.
  Fly   235 CHVK-QPATSAQDIGPIYWYRGPYILTPFVAHPNDAAIDLQRISMESTLAEKLQSRLRI---ANA 295

Human   287 RLLATQPDDAGCYTCVPSNGLLHPPSASAYLTVLYPAQVTAM 328
            :||     |.|.|||:|:..    .:||..:.|:......||
  Fly   296 QLL-----DTGNYTCMPTTA----EAASVVVNVINDESPAAM 328

Known Domains:


GeneSequenceDomainRegion External IDIdentity
IGSF9NP_001128522.1 Ig 24..132 CDD:299845 15/60 (25%)
IG_like 28..110 CDD:214653 12/38 (32%)
I-set 136..223 CDD:254352 21/103 (20%)
Ig 154..220 CDD:143165 17/81 (21%)
Ig_3 226..305 CDD:290638 28/108 (26%)
IG_like 233..319 CDD:214653 27/112 (24%)
Ig 341..404 CDD:299845
IG_like 431..503 CDD:214653
Ig 436..500 CDD:143165
fn3 511..596 CDD:278470
FN3 625..715 CDD:238020
PDZ-binding. {ECO:0000250} 1177..1179
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 19/95 (20%)
Ig 116..192 CDD:299845 14/77 (18%)
ig 220..306 CDD:278476 24/95 (25%)
IG_like 220..306 CDD:214653 24/95 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.