DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IGSF9 and dpr3

DIOPT Version :9

Sequence 1:NP_001128522.1 Gene:IGSF9 / 57549 HGNCID:18132 Length:1179 Species:Homo sapiens
Sequence 2:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster


Alignment Length:351 Identity:64/351 - (18%)
Similarity:101/351 - (28%) Gaps:151/351 - (43%)


- Green bases have known domain annotations that are detailed below.


Human    64 LPIFIQFGLYSPRIDPDYVGRVRLQKGASLQIEGLRVEDQGWYECRVFFL-DQHIPEDDFANGSW 127
            |||| .||:  ||                 .|.|.....:...:|||..| |:.:        ||
  Fly   235 LPIF-DFGM--PR-----------------NITGRTGHTEAIIKCRVDSLHDKSV--------SW 271

Human   128 V-----HL------TVNSPPQFQETPPAVLEVQELEPVTLRCVARGSPLPHVTWKLRGKDLGQGQ 181
            :     |:      |..|..:||.|                               ..||     
  Fly   272 IRKRDLHILTVGTATYTSDKRFQVT-------------------------------ESKD----- 300

Human   182 GQVQVQNGTLRIRRVERGSSGVYTCQASSTEGSATHATQLLVL----GPPVIVVPPKNSTVNASQ 242
                .:..||.::......||:|.||. :||...:.|.||.::    ....::..|.:....|..
  Fly   301 ----SREWTLHVKAPLAKDSGIYECQV-NTEPKMSMAFQLNIIEISPDAKAVISGPPDLHFKAGS 360

Human   243 DVSLAC----------------------------------------HAEAYPANLTYSWFQDNIN 267
            .:.|.|                                        |.:..|.:.:.:.....::
  Fly   361 AIILNCLVQQPSVKDIGPIYWYRGEHMITPFDADDGQPEIPAGRGEHPQGIPEDTSPNDIMSEVD 425

Human   268 VFHISRLQPRVRILVDGS--------LRLLATQPDDAGCYTCVPSNGLLHPPSASAYLTVLYPAQ 324
            :    :::...||.::..        ||:...|..|.|.|||.|:..    .|||..:.|:    
  Fly   426 L----QMEFATRIAMESQLGDTLKSRLRISNAQTTDTGNYTCQPTTA----SSASVLVHVI---- 478

Human   325 VTAMPPETPLPIGMPGVIRCPVRANP 350
                ..|.|..:...|.  ||....|
  Fly   479 ----NDENPAAMQKSGA--CPCALGP 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IGSF9NP_001128522.1 Ig 24..132 CDD:299845 18/79 (23%)
IG_like 28..110 CDD:214653 11/45 (24%)
I-set 136..223 CDD:254352 17/86 (20%)
Ig 154..220 CDD:143165 12/65 (18%)
Ig_3 226..305 CDD:290638 17/126 (13%)
IG_like 233..319 CDD:214653 20/133 (15%)
Ig 341..404 CDD:299845 3/10 (30%)
IG_like 431..503 CDD:214653
Ig 436..500 CDD:143165
fn3 511..596 CDD:278470
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 606..626
FN3 625..715 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 767..919
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 940..988
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1015..1079
PDZ-binding. /evidence=ECO:0000250 1177..1179
dpr3NP_001014459.2 Ig 243..330 CDD:299845 28/152 (18%)
IG_like 243..329 CDD:214653 28/151 (19%)
Ig 350..464 CDD:299845 15/117 (13%)
IG_like <441..477 CDD:214653 12/39 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.