DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: IGSF9 and CG33543

Sequence 1:NP_001128522.1 Gene:IGSF9 HGNCID:18132 Length:1179 Species:Homo sapiens
Sequence 2:NP_001014458.3 Gene:CG33543 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster

Alignment Length:565 Identity:109/566 (19%)
Similarity:169/566 (30%) Gaps:201/566 (36%)


Human   131 TVNSPPQFQETPPAVLEVQELEPVTLRCVARGSPLPHVT---------------------WK-LR 173
            |..:||....|||.     .|:|.|          |.:|                     |: .|
  Fly    35 TGGAPPDRPPTPPL-----SLQPST----------PSITHFVNESFIIFCQTVQKDIDTKWRDPR 84

Human   174 GKDLGQGQGQVQVQNGT-----LRIRRVERGSSGVYTCQASSTEGSATHATQLLVLGPPVIVVPP 233
            |:.....:|:|.::..|     |....:.....|.:||:.:.....                   
  Fly    85 GQTRENTKGRVHIEKKTTGLLALVFEHIALEDRGNWTCEVNGNRNG------------------- 130

Human   234 KNSTVNASQDVSLACHAEAYPANLTYSWFQDNINVFHISRLQPRVRILVDGSLRLLATQPDDAGC 298
             |..||..::. ||                                     |..||..|....|.
  Fly   131 -NRNVNVEREF-LA-------------------------------------SFELLVNQKISFGK 156

Human   299 YTCVPSNGLLHPPSASAYLTVLYPAQVTAMPPETPLPIGMPGVIRCPVRANP-PLLFVSWTKDGK 362
            ...|.|                             :..|...::.|.|...| |  .|||..:|:
  Fly   157 TEQVQS-----------------------------VREGRDAMVNCFVEGMPAP--EVSWLYNGE 190

Human   363 ALQLDKFPGWSQGTEGSLIIALGNEDALGEYSCTPYNSLGTAGPSPVTRVLLKAPPAFIERPKEE 427
            .:........::.:.|..|..:...|| |||:|.......|...|....:||:     |:.....
  Fly   191 YINTVNSTKHNRLSNGLYIRNVSQADA-GEYTCRAMRITPTFSDSDQITILLR-----IQHKPHW 249

Human   428 YFQE--------VGRELLIPCSAQGDPPPVVSWTKVGRGLQGQAQ----VDSNSSLILRPLTKEA 480
            :|.|        ||..:.:.|.|.|:|||..:|....:|:.|...    .|..::|.|:......
  Fly   250 FFNETLPVQYAYVGGAVNLSCDAMGEPPPSFTWLHNNKGIVGFNHRIFVADYGATLQLQMKNASQ 314

Human   481 HGHWECSASNAVA-----------------RVATSTNVYVLGTSPHVVTNVSVVALPKGANVSWE 528
            .|.::|..:|.:.                 |......:|..|....:.|       |:.:|||.|
  Fly   315 FGDYKCKVANPLGMLERVIKLRPGPKPLGPRRFQLKKLYTNGFELDIQT-------PRMSNVSDE 372

Human   529 P---GFDGGYLQ----RFSVWYTPLAKRPDRMHHDWVSLAVPVGAAHLLVPGLQPHTQYQFSVLA 586
            .   |:...|:.    :||......||:.|...|         |..|.::|.|:.:|.|.....:
  Fly   373 MQIYGYRVAYMSDTEFKFSAGNWSYAKQRDFSFH---------GGKHFIIPHLETNTTYLMRAAS 428

Human   587 QNKLGSGPFSEIVLSAPEGLPTTPAAPGLPPTEIPPPLSPPRGLV 631
            :|..|...:|      |..:.||.|.....|.     |.|..||:
  Fly   429 RNLAGLSDWS------PVKVFTTAAGCSWSPW-----LYPSYGLI 462

Known Domains:


GeneSequenceDomainRegion External IDIdentity
IGSF9NP_001128522.1 Ig 24..132 CDD:299845 1/1 (100%)
IG_like 28..110 CDD:214653
I-set 136..223 CDD:254352 19/114 (17%)
Ig 154..220 CDD:143165 13/93 (14%)
Ig_3 226..305 CDD:290638 12/79 (15%)
IG_like 233..319 CDD:214653 12/86 (14%)
Ig 341..404 CDD:299845 17/64 (27%)
IG_like 431..503 CDD:214653 20/101 (20%)
Ig 436..500 CDD:143165 16/85 (19%)
fn3 511..596 CDD:278470 22/92 (24%)
FN3 625..715 CDD:238020 3/8 (38%)
PDZ-binding. {ECO:0000250} 1177..1179
CG33543NP_001014458.3 IGc2 165..224 CDD:197706 17/62 (27%)
IG_like 256..336 CDD:214653 17/80 (21%)
IGc2 263..327 CDD:197706 16/64 (25%)
FN3 341..445 CDD:238020 28/126 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.