DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: IGSF9 and dpr4

Sequence 1:NP_001128522.1 Gene:IGSF9 HGNCID:18132 Length:1179 Species:Homo sapiens
Sequence 2:NP_001014616.2 Gene:dpr4 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster

Alignment Length:245 Identity:58/246 (24%)
Similarity:93/246 (38%) Gaps:59/246 (24%)


Human   135 PPQFQETP--PAVLEVQELEPVT--------LRCVARGSPLPHVTWKLRGKDL------------ 177
            ||.:.|||  ....:......||        |.|..|......|:| :|.:||            
  Fly    34 PPHYWETPYSQPYFDNSSRREVTATVGQAALLHCRVRNLGDRAVSW-IRKRDLHILTVGILTYTN 97

Human   178 --------GQGQGQVQVQNGTLRIRRVERGSSGVYTCQASSTEGSATHATQLLVLGPPVIVVPPK 234
                    .:|..:     .||||...:...||.|.||. |||...:...:|.|:.....::...
  Fly    98 DQRFQSLHSEGSDE-----WTLRISSPQPRDSGTYECQV-STEPKISQGFRLNVVVSRAKILGNA 156

Human   235 NSTVNASQDVSLACHAEAYPANLTYSWFQDNINVFHISRLQPRVRILVDGSLR----LLA-TQPD 294
            ...:.:..|::|.|.|...|...::.::.....|.:.|: :..:.::.:.|.|    |:| ..|.
  Fly   157 ELFIKSGSDINLTCLAMQSPVPPSFIYWYKGKRVMNYSQ-RGGINVITERSTRTSKLLIAKATPA 220

Human   295 DAGCYTCVPS------------NGLLHPPS---ASAYLTVLYPAQVTAMP 329
            |:|.|||.||            || .||.:   .::..|.|.|...|::|
  Fly   221 DSGNYTCSPSSSDSASVVVHVING-EHPAAMQHGNSSATCLRPLSSTSVP 269

Known Domains:


GeneSequenceDomainRegion External IDIdentity
IGSF9NP_001128522.1 Ig 24..132 CDD:299845
IG_like 28..110 CDD:214653
I-set 136..223 CDD:254352 28/117 (24%)
Ig 154..220 CDD:143165 23/94 (24%)
Ig_3 226..305 CDD:290638 19/96 (20%)
IG_like 233..319 CDD:214653 24/106 (23%)
Ig 341..404 CDD:299845
IG_like 431..503 CDD:214653
Ig 436..500 CDD:143165
fn3 511..596 CDD:278470
FN3 625..715 CDD:238020
PDZ-binding. {ECO:0000250} 1177..1179
dpr4NP_001014616.2 V-set 53..146 CDD:284989 25/100 (25%)
IG_like 53..145 CDD:214653 24/99 (24%)
ig 153..227 CDD:278476 16/75 (21%)
IG_like 161..>227 CDD:214653 16/67 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.