DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: IGSF9 and DIP-beta

Sequence 1:NP_001128522.1 Gene:IGSF9 HGNCID:18132 Length:1179 Species:Homo sapiens
Sequence 2:NP_001138225.1 Gene:DIP-beta FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster

Alignment Length:263 Identity:64/264 (24%)
Similarity:96/264 (36%) Gaps:89/264 (34%)


Human    92 SLQIEGLRVEDQGWYECRVFFLDQHIPEDDFANGSWVHLTVNSPPQFQET-------PPAVLE-- 147
            :|.|.|:::||.|.|.|:                      ||:.|...:|       ||.::.  
  Fly   175 TLNIRGVKMEDAGKYMCQ----------------------VNTDPMKMQTATLEVVI
PPDIINEE 217

Human   148 ------VQELEPVTLRCVARGSPLPHVTWKLR-GKDLGQGQGQVQ------VQNGTLRIRRVERG 199
                  |.|.....|.|.|||.|.|.:||:.. |:::....|..|      |:...|.:.::.|.
  Fly   218 TSGDMMVPEGGSAKLVCRARGHPKPKITWRREDGREIIARNGSHQKTKAQSVEGEMLTLSKITRS 282

Human   200 SSGVYTCQASS-TEGSATHATQLLVLGPPVIVVPPKNSTVNAS--QDVSLACHAEAYPANLTYSW 261
            ..|.|.|.||: ...:.:...:|.|...|::.||  |..|.|.  .||:|.|:.||.|..:.| |
  Fly   283 EMGAYMCIASNGVPPTVSKRMKLQVHFHPLVQVP--NQLVGAPVLTDVTLICNVEASPKAINY-W 344

Human   262 FQDNIN----------------------VFHISRLQPRVRILVDGSLRLLATQPDDAGCYTCVPS 304
            .::|..                      :.||.||                 |..|.|.|.|:..
  Fly   345 QRENGEMIIAGDRYALTEKENNMYAIEMILHIKRL-----------------QSSDFGGYKCISK 392

Human   305 NGL 307
            |.:
  Fly   393 NSI 395

Known Domains:


GeneSequenceDomainRegion External IDIdentity
IGSF9NP_001128522.1 Ig 24..132 CDD:299845 8/40 (20%)
IG_like 28..110 CDD:214653 8/18 (44%)
I-set 136..223 CDD:254352 27/110 (25%)
Ig 154..220 CDD:143165 20/74 (27%)
Ig_3 226..305 CDD:290638 25/103 (24%)
IG_like 233..319 CDD:214653 23/100 (23%)
Ig 341..404 CDD:299845
IG_like 431..503 CDD:214653
Ig 436..500 CDD:143165
fn3 511..596 CDD:278470
FN3 625..715 CDD:238020
PDZ-binding. {ECO:0000250} 1177..1179
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 12/56 (21%)
ig 102..195 CDD:278476 10/42 (24%)
IG_like 219..307 CDD:214653 23/88 (26%)
Ig 221..307 CDD:299845 23/86 (27%)
Ig 311..404 CDD:299845 26/106 (25%)
IG_like 327..405 CDD:214653 20/88 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.