DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: IGSF9 and dpr8

Sequence 1:NP_001128522.1 Gene:IGSF9 HGNCID:18132 Length:1179 Species:Homo sapiens
Sequence 2:NP_001285239.1 Gene:dpr8 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster

Alignment Length:243 Identity:58/244 (24%)
Similarity:92/244 (38%) Gaps:53/244 (22%)


Human   154 VTLRCVARGSPLPHVTWKLRGKDLG---------------QGQGQVQVQNGTLRIRRVERGSSGV 203
            |.|.|..:......|:| :|.:|:.               :.......::.|||||..:|..||:
  Fly    60 VKLTCRVKNLGNRTVSW-VRHRDIHLLTVGRYTYTSDQRFEAMHSPHAEDWTLRIRYAQRKDSGI 123

Human   204 YTCQASSTEGSATHATQLLVLGPPVIVVPPKNSTVNASQDVSLAC---HAEAYPANLTYSWFQDN 265
            |.||.|:|. ...|:..|.::.|...::......:|....::|.|   .|...|..:.:|..::.
  Fly   124 YECQISTTP-PIGHSVYLNIV
EPVTDIIGGPELHINRGSTINLTCIVKFAPEPPPTVIWSHNREI 187

Human   266 INVFHISR----LQPRVRILVDGSLRLLATQPDDAGCYTCVPSNGLLHPPSASAYLT-VLYPAQV 325
            || |...|    |.....:|....|.:......|:|.|||.|||.  :|.|...::. ..:||.:
  Fly   188 IN-FDSPRGGISLVTEKGVLTTSRLLVQKAITQDSGLYTCTPSNA--NPTSVRVHIVDGEHPAAM 249

Human   326 --------TAMPPETPLPIGMPGVIRCP--------------VRANPP 351
                    ||..|...||:.:   :.|.              |.|.||
  Fly   250 HTGNNGNSTASQPPVLLPLVL---LTCSTLMLLQLVASCSTLVPATPP 294

Known Domains:


GeneSequenceDomainRegion External IDIdentity
IGSF9NP_001128522.1 Ig 24..132 CDD:299845
IG_like 28..110 CDD:214653
I-set 136..223 CDD:254352 22/84 (26%)
Ig 154..220 CDD:143165 21/81 (26%)
Ig_3 226..305 CDD:290638 21/86 (24%)
IG_like 233..319 CDD:214653 23/94 (24%)
Ig 341..404 CDD:299845 5/26 (19%)
IG_like 431..503 CDD:214653
Ig 436..500 CDD:143165
fn3 511..596 CDD:278470
FN3 625..715 CDD:238020
PDZ-binding. {ECO:0000250} 1177..1179
dpr8NP_001285239.1 IG_like 51..131 CDD:214653 19/72 (26%)
V-set 52..143 CDD:284989 22/85 (26%)
IG_like 153..238 CDD:214653 23/88 (26%)
ig 153..232 CDD:278476 21/82 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.