DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: IGSF9 and DIP-kappa

Sequence 1:NP_001128522.1 Gene:IGSF9 HGNCID:18132 Length:1179 Species:Homo sapiens
Sequence 2:NP_723828.1 Gene:DIP-kappa FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster

Alignment Length:619 Identity:140/620 (23%)
Similarity:216/620 (35%) Gaps:192/620 (31%)


Human    26 VVSVVGRAGESVVLGCDLLPPAGRPPLHVIEWLRFGFLLPIFIQFGLYSPRIDPDYVGRVRL--- 87
            :.:|....|...::.|.:....|    :.:.|:|......:.|...:.|..      .|:.|   
  Fly    80 IANVTVSVGRDALMACVVENLKG----YKVAWVRVDTQTILSIHHNVISQN------SRISLTYN 134

Human    88 -QKGASLQIEGLRVEDQGWYECRVFFLDQHIPEDDFANGSWVHLTVNSPPQFQE-------TPPA 144
             .:...|.|:.:...|:|||.|:                      ||:.|....       .||.
  Fly   135 DHRSWYLHIKEVEETDRGWYMCQ----------------------VNTDPMRSRKGYLQVVVPPI 177

Human   145 VLE--------VQELEPVTLRCVARGSPLPHVTWKLR-GKDLGQGQGQVQVQNG-TLRIRRVERG 199
            ::|        |:|.:.::|.|.|||.|.|:|.|:.. |:::..|...|.|.:| .|.|.:|.|.
  Fly   178 IVEGLTSNDMVVREGQNISLVCKARGYPEPYVMWRREDGEEMLIGGEHVNVVDGELLHITKVSRL 242

Human   200 SSGVYTCQASS-TEGSATHATQLLVLGPPVIVVPPKNSTVNASQDVSLACHAEAYPANLTYSWFQ 263
            ....|.|.||: ...|.:....|.|..||::.:|.:.......|||.|.||.|||||::.| |..
  Fly   243 HMAAYLCVASNGVPPSISKRVHLRVQFPPMLSIPNQLEGAYLGQDVILECHTEAYPASINY-WTT 306

Human   264 D--NINVFHISRLQPRVRI--LVDG-----SLRLLATQPDDAGCYTCVPSNGLLHPPSASAYLTV 319
            :  ::.:...||...:...  .|.|     .|::.|..|:|.|.|.||..|. |.....:..|..
  Fly   307 ERGDMIISDTSRAGDKYETTSTVSGYTKYMKLKIRAVGPNDFGTYRCVAKNS-LGETDGNIKLDE 370

Human   320 LYPAQVTAMPPETPLPIGMPGVIRCPVRANPPLLFVSWTKDGKALQLDKFPG-----------WS 373
            : |...||:..|..|                    ::.:.|||....:||..           |.
  Fly   371 M-PTPTTAIISEMSL--------------------LNRSYDGKRRHRNKFDSANALPDYGVEEWR 414

Human   374 QGTEGSLIIALGNEDALGEYSCTP--------YNSLGT-AGPSPVTRVLLKAPPAFIERPKEEYF 429
            .|.:|:   ..||.   |:.:.||        :||.|: |..:.:.:::|.     |:......|
  Fly   415 DGAQGN---NAGNN---GDNNQTPVRNPPGAFHNSAGSLAQHNLLAKIMLG-----IKTQSFGIF 468

Human   430 QEVGRELLIPCSAQGDPPPVVSWTKVGRGLQGQAQV-DSNSSLILRPLTKEAHGHWECSASNAVA 493
            :.:...|  |.:|                  ||:.: .|..||:..|      ..|..|      
  Fly   469 KRLSSSL--PLAA------------------GQSFLWLSTLSLVSAP------SRWRMS------ 501

Human   494 RVATSTNVYVLGTSPHVVTNVSVVALPKGANVSWEP----------GFDGGYLQRFSVWYTPLAK 548
                  ||.....||..|.|....|      ..||.          ..:....||..:|...|  
  Fly   502 ------NVENRPNSPETVVNNDTAA------ECWETRSHCVSESNNNNNSRITQRPPMWARHL-- 552

Human   549 RPDRMHHDWVSLA-VPVGAAHLLVPGLQPHTQYQ 581
               |:.|    :| .|.||:          ||||
  Fly   553 ---RIFH----IAHTPCGAS----------TQYQ 569

Known Domains:


GeneSequenceDomainRegion External IDIdentity
IGSF9NP_001128522.1 Ig 24..132 CDD:299845 17/110 (15%)
IG_like 28..110 CDD:214653 17/86 (20%)
I-set 136..223 CDD:254352 30/105 (29%)
Ig 154..220 CDD:143165 23/69 (33%)
Ig_3 226..305 CDD:290638 28/88 (32%)
IG_like 233..319 CDD:214653 28/95 (29%)
Ig 341..404 CDD:299845 16/83 (19%)
IG_like 431..503 CDD:214653 13/73 (18%)
Ig 436..500 CDD:143165 11/65 (17%)
fn3 511..596 CDD:278470 19/83 (23%)
FN3 625..715 CDD:238020
PDZ-binding. {ECO:0000250} 1177..1179
DIP-kappaNP_723828.1 Ig 80..172 CDD:299845 20/124 (16%)
IG_like 82..174 CDD:214653 20/124 (16%)
IG_like 184..267 CDD:214653 26/83 (31%)
IGc2 191..255 CDD:197706 23/64 (36%)
IG_like 282..368 CDD:214653 27/88 (31%)
Ig 288..367 CDD:143165 25/81 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.