DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: IGSF9 and Fas2

Sequence 1:NP_001128522.1 Gene:IGSF9 HGNCID:18132 Length:1179 Species:Homo sapiens
Sequence 2:NP_001284854.1 Gene:Fas2 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster

Alignment Length:940 Identity:216/941 (23%)
Similarity:332/941 (35%) Gaps:216/941 (23%)


Human    34 GESVVLGCDLLPPAGRPPLHV-IEWL--RFGFLLPIFIQFGLYSP--RIDPDYVGRVRLQKGASL 93
            |:.::|.|  .|....|.|.. ::|.  |...:||        .|  |..|.........:..:|
  Fly    47 GKPLILTC--RPTVPEPSLVADLQWKDNRNNTILP--------KPNGRNQPPMYTETLPGESLAL 101

Human    94 QIEGLRVEDQGWYECRVFFLDQHIPEDDFANGSWVHLTVNSPPQFQETPPAVLEVQELEPVTLRC 158
            .|..|.||..|.|.|...:.:..|.|......::|.:|..:.|:.|.....       :...:.|
  Fly   102 MITSLSVEMGGKYYCTASYANTEILEKGVTIK
TYVAITWTNAPENQYPTLG-------QDYVVMC 159

Human   159 VARGSPLPHVTWKLRGKDLGQGQGQVQVQNGTLRIRRVERGSSGVYTCQASSTE-GSATHAT-QL 221
            ..:..|.|.:.|...|..:.....:..||...|.||.|:....|:|||:|:..| |.....| ::
  Fly   160 EVKADPNPTIDWLRNGDPIRTTNDKYVVQTNGLLIRNVQESDEGIYTCRAAVIETGELLERTIRV 224

Human   222 LVLGPPVIVVPPKNSTVNASQDVSLACHAEAYPANLTYSWFQD--NINVFHISRLQ--PRVRILV 282
            .|...|.|:..|.|......:..:..|.|...|.. ..||.:|  .:||....|.|  |:.    
  Fly   225 EV
FIQPEIISLPTNLEAVEGKPFAANCTARGKPVP-EISWIRDATQLNVATADRFQVNPQT---- 284

Human   283 DGSLRLLATQPDDAGCYTCVPSN--GLLHPPSASAYLTVLYPAQV-------TAMPPETPLPIGM 338
             |.:.:.:...||.|.|||:..|  |::   .....|.||...|:       .|...|..:    
  Fly   285 -GLVTISSVSQDDYGTYTCLAKNRAGVV---DQKTKLNVLVRPQIYELYNVTGARTKEIAI---- 341

Human   339 PGVIRCPVRANPPLLFVSW-----------TKDGKAL---QLDKFPGWSQGTEGSLIIALGNEDA 389
              ..|...|..|.:.|..|           ..|.:.:   ..|:..|.|.||   |.|:......
  Fly   342 --TCRAKGRPAPAITFRRWGTQEEYTNGQQDDDPRIILEPNFDEERGESTGT---LRISNAERSD 401

Human   390 LGEYSCTPYNSLGTAGPSPVTRVLLKAPPAFIERPKE--EYFQEVGRELLIPCSAQGDPPPVVSW 452
            .|.|.|...|.  .|.......:.::..|.| ...||  ..|....|:..:.|.|.|.|...:.|
  Fly   402 DGLYQCIARNK--GADAYKTGHITVEFAPDF-SHMKELPPVFSWEQRKANLSCLAMGIPNATIEW 463

Human   453 TKVGRGLQGQAQVDSN---------SSLILRPLTKEAHGHWECSASN-----------AVARVAT 497
            ...||.::.  ..|:|         |.||:.|:|::.:..::|.|:|           ..|||..
  Fly   464 HWNGRKIKD--LYDTNLKIVGTGPRSDLIVHPVTRQYYSGYKCIATNIHGTAEHDMQLKEARVPD 526

Human   498 STNVYVLGTSPHVVTNVSVVALPKGANVSWEPGFDGGYLQRFSVWYTPLAKRPDRMHHDWVSLAV 562
                :|....|..:|..::....:|.  |.|.|..   :..:||.|      .:.::.||     
  Fly   527 ----FVSEAKPSQLTATTMTFDIRGP--STELGLP---ILAYSVQY------KEALNPDW----- 571

Human   563 PVGAAH---------LLVPGLQPHTQYQFSVLAQNKLGSGPFSEIVLSAPEGLPTTPAAPGLPPT 618
              ..|:         .:|.||:|.|:|.|...|:|::|.|.:         |:....:.|.....
  Fly   572 --STAYNRSWSPDSPYIVEGLRPQTEYSFRFAARNQVGLGNW---------GVNQQQSTPRRSAP 625

Human   619 EIPPPLSPP----RGLVAVRTPRG--VLLHWDPPELVPKRLDGYVLE---GRQGSQGWEVLDPAV 674
            |.|.||..|    :....|.:|..  ..|.|..|....:.:|.|.::   |.:.|..|..|:.:.
  Fly   626 EEPKPLHNPVQHDKEEPVVVSPYSDHFELRWGVPADNGEPIDRYQIKYCPGVKISGTWTELENSC 690

Human   675 AGTE----TELLVPGLIKDVLYEFRLVAFAGSFVSDPSNTANVSTSGLEVYPSRTQLPGLLPQPV 735
            ...|    |...:..|:.:..|...|.|......|.|::....:|.|::|.....:  .:.....
  Fly   691 NTVEVMETTSFEMTQLVGNTYYRIELKAHNAIGYSSPASIIMKTTRGIDVIQVAER--QVFSSAA 753

Human   736 LAGV-VGGVCFLGVAV----LVSILAGCLLNRRRAARRRRKRLRQDPPLIFSPTGKSAAPSALGS 795
            :.|: :|||..|...|    .:::..|.:....|.|:|                    :||.:  
  Fly   754 IVGIAIGGVLLLLFVVDLLCCITVHMGVMATMCRKAKR--------------------SPSEI-- 796

Human   796 GSPDSVAKL-KLQG--SPVPSLRQSLLWGDPAGTPSPHP-DPPSSRGPLPL-------EPICRGP 849
               |..||| .|.|  .|:|.....|:...|   |||.| .||...|..|:       ||: |.|
  Fly   797 ---DDEAKLGSLYGWRFPLPYCSGQLVKEPP---PSPLPLPPPVKLGGSPMSTPLDEKEPL-RTP 854

Human   850 ------------DGRFVMGPTVAAPQERSG 867
                        |||||        ..|||
  Fly   855 TGSIKQNSTIEFDGRFV--------HSRSG 876

Known Domains:


GeneSequenceDomainRegion External IDIdentity
IGSF9NP_001128522.1 Ig 24..132 CDD:299845 25/103 (24%)
IG_like 28..110 CDD:214653 21/81 (26%)
I-set 136..223 CDD:254352 21/89 (24%)
Ig 154..220 CDD:143165 19/68 (28%)
Ig_3 226..305 CDD:290638 22/83 (27%)
IG_like 233..319 CDD:214653 23/92 (25%)
Ig 341..404 CDD:299845 17/77 (22%)
IG_like 431..503 CDD:214653 21/92 (23%)
Ig 436..500 CDD:143165 20/84 (24%)
fn3 511..596 CDD:278470 22/94 (23%)
FN3 625..715 CDD:238020 20/103 (19%)
PDZ-binding. {ECO:0000250} 1177..1179
Fas2NP_001284854.1 IG_like 39..133 CDD:214653 23/96 (24%)
IG_like 144..226 CDD:214653 21/89 (24%)
IGc2 152..209 CDD:197706 15/64 (23%)
I-set 230..319 CDD:254352 25/98 (26%)
IGc2 243..309 CDD:197706 19/72 (26%)
IG_like 330..424 CDD:214653 20/105 (19%)
IGc2 339..412 CDD:197706 17/82 (21%)
Ig 447..518 CDD:143165 17/73 (23%)
fn3 534..611 CDD:278470 22/95 (23%)
FN3 640..735 CDD:238020 19/95 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.