DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: IGSF9 and kirre

Sequence 1:NP_001128522.1 Gene:IGSF9 HGNCID:18132 Length:1179 Species:Homo sapiens
Sequence 2:NP_001245505.1 Gene:kirre FlyBaseID:FBgn0028369 Length:956 Species:Drosophila melanogaster

Alignment Length:1009 Identity:191/1010 (19%)
Similarity:309/1010 (31%) Gaps:347/1010 (34%)


Human    16 QGADGRG-----KPEVVSVVGRAGESVVLGCDLLPPAGRPPLHVIEWLR--FGF----LLPIFIQ 69
            :|.|..|     :|:..:.|  .|..|.|.|.::...|     .::|.:  ||.    .|..|.:
  Fly    75 KGGDNGGQHFAMEPQDQTAV--VGSRVTLPCRVMEKVG-----ALQWTKDDFGLGQHRNLSGFER 132

Human    70 FGLYSPRIDPDYVGRVRLQKGASLQIEGLRVEDQGWYECRVFFLDQHIPEDDFANG---SWVHLT 131
            :.:.....:.|:          ||.|..|.::|...|:|:|.      |......|   .:..||
  Fly   133 YSMVGSDEEGDF----------SLDIYPLMLDDDAKYQCQVG------PGPQGEQGIRSRFAKLT 181

Human   132 VNSPPQFQE-TPPAVLEVQELEPVTLRCVAR-GSPLPHVTWKLRGKDLGQGQGQV------QVQN 188
            |..||:..: |....|...|...:.|.||:: |.|...:||.       .|.|.|      .|:.
  Fly   182 VLVPPEAPKITQGDYLVTTEDREIELECVSQGGKPAAEITWI-------DGLGNVLTKGIEYVKE 239

Human   189 GTLRIRRVERGS-----------SGVYTCQASSTEGSATHATQLLV---LGPPVIVVPPKNSTVN 239
            .....||:...|           :..:||||.:|......:.:||:   ..|.|||     |.|.
  Fly   240 PLADSRRITARSILKLAPKKEHHNTTFTCQAQNTADRTYRSAKLLLEVKYAPKVIV-----SVVG 299

Human   240 AS---------QDVSLACHAEAYPANLTYSWFQDNINVFHISRLQPRVRILVDGSLRLLATQPDD 295
            .:         .:|.|:|.|:|.|..|:|.||   ||                          |:
  Fly   300 GALAGGKIPEGAEVILSCQADANPHELSYRWF---IN--------------------------DE 335

Human   296 --AGCYTCVPSNGLLHPPSASAYLTVLYPAQVTAMPPETPLPIGMPGVIRCPVRANPPLLFVSWT 358
              .|.:|   :..::|..|...:                      ..:::|.| .|..       
  Fly   336 LMTGDFT---TKMIIHNVSRQYH----------------------DAIVKCEV-VNAV------- 367

Human   359 KDGKALQLDKFPGWSQGTEGSLIIALGNEDALGEYSCTPYNSLGTAGPSPVTRVLLKAPPAFIER 423
              ||:.|..|           |.|:.|                                |.|.:|
  Fly   368 --GKSEQSKK-----------LDISFG--------------------------------PVFRQR 387

Human   424 PKEEYFQEVGRELLIPCSAQGDPPPVVSWTKVGRGLQGQAQVDSNSSLILRPLTKEAHGHWECSA 488
            | .....::|..:.:.|...|:|.|.:.|..     :...||...::.:...::.|..|.:.|.|
  Fly   388 P-VSVEADLGATVSMRCDVAGNPEPEIEWIS-----ENSDQVVGVAAELKLKVSSETAGRYFCKA 446

Human   489 -SNAVARVATSTNVYVL-------------GTSPHVVTNVSVVALPKGANVSWEPGFDGGYLQRF 539
             .|....:.....:||.             |....|..:....::||..::.|  .|:|..:...
  Fly   447 VVNGFPEIGAEATLYVKRAPIITSHKVQFGGVGGRVKIDCLAFSIPKAEHILW--SFEGKIINMS 509

Human   540 SVWYTPLAKRPD----RMHHDWVSLAVPVGAAHLLVPGLQPHTQY-QFSVLAQNKLGSGPFSEIV 599
            |.       .||    ..||      :|.|....|:......|.: :::....|..|.......:
  Fly   510 SA-------DPDIYIFEEHH------LPEGVRAALIIRDSKATHFGKYNCTVMNSYGGDSLVITL 561

Human   600 LSAPEGLPTTPAAPGLPPTEIPPPLSPPRGLVAV-------------RTPRGVLLHWDPPELVPK 651
            |..|..:|......|            ....||:             |..|...:   |.:::| 
  Fly   562 LREPGNIPVLLVVMG------------SMFCVAIILMIVMIIIVYRKRRSRKKPM---PADVIP- 610

Human   652 RLDGYVLEGRQGSQGWEVLDPAVAGTETELLVPGLIKDVLYEFRLVAFAGSFVSDPSNTANVSTS 716
                      :.|:|.:.|:                 ::..|.|..|:...:       :.....
  Fly   611 ----------EASRGGDKLN-----------------ELKSELRSKAYDVEY-------SEAGGD 641

Human   717 GLEVYPSRTQLPGLLPQPVLAGVVGGVCFLGVAVLVSILAG----------C----LLNRRRAAR 767
            ||.:  :.||.|  :|...:.|...||...|........:|          |    |.|::..|.
  Fly   642 GLAI--NLTQSP--MPDVQMKGATLGVPLAGPVKFDERFSGDFGGDRYNRQCHIKNLKNQQETAY 702

Human   768 RRRKRLRQ-----DPPLIFSPTGKSAAPSALGSGSPDSVAKLK---LQGSPVPSLRQSLLWGDPA 824
            :...:...     :..|.:||.|...|...:|||   .|.|||   :..:.:|....:.:.|..|
  Fly   703 KGSPQANGYAHYFEYALDYSPPGGEGAAVVVGSG---GVGKLKNGGMNSATLPHSAAATVNGGGA 764

Human   825 GTPSPHPDPPSSRGPLPLEPICRGPDGRFVMGPTVAAPQERSGREQAEPRTPAQRLARSFDCSSS 889
            |.......|.:.|..:.......|    |:..|.                     |....|...|
  Fly   765 GNGGGASLPRNQRHEIQQSQQSNG----FLGQPL---------------------LQNGIDSRFS 804

Human   890 SPSGAPQPLCIEDISPVAPPPA-APPSPLPGPGP 922
            :..|.|.......:.|..|||: |.|:..|.|.|
  Fly   805 AIYGNPYLRTNSSLLPPLPPPSTANPAATPAPPP 838

Known Domains:


GeneSequenceDomainRegion External IDIdentity
IGSF9NP_001128522.1 Ig 24..132 CDD:299845 25/117 (21%)
IG_like 28..110 CDD:214653 19/88 (22%)
I-set 136..223 CDD:254352 25/106 (24%)
Ig 154..220 CDD:143165 19/84 (23%)
Ig_3 226..305 CDD:290638 21/90 (23%)
IG_like 233..319 CDD:214653 19/97 (20%)
Ig 341..404 CDD:299845 10/63 (16%)
IG_like 431..503 CDD:214653 14/73 (19%)
Ig 436..500 CDD:143165 12/65 (18%)
fn3 511..596 CDD:278470 16/90 (18%)
FN3 625..715 CDD:238020 12/103 (12%)
PDZ-binding. {ECO:0000250} 1177..1179
kirreNP_001245505.1 Ig 87..183 CDD:299845 26/119 (22%)
IG_like 88..182 CDD:214653 25/117 (21%)
C2-set_2 189..279 CDD:285423 22/97 (23%)
Ig_2 307..379 CDD:290606 26/147 (18%)
I-set 382..462 CDD:254352 18/86 (21%)
IGc2 396..446 CDD:197706 11/55 (20%)
Ig 466..561 CDD:299845 18/110 (16%)
IG_like 478..561 CDD:214653 17/98 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.