DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: IGSF9 and rst

Sequence 1:NP_001128522.1 Gene:IGSF9 HGNCID:18132 Length:1179 Species:Homo sapiens
Sequence 2:NP_001284835.1 Gene:rst FlyBaseID:FBgn0003285 Length:764 Species:Drosophila melanogaster

Alignment Length:808 Identity:167/809 (21%)
Similarity:253/809 (31%) Gaps:277/809 (34%)


Human    34 GESVVLGCDLLPPAGRPPLHVIEWLRFGFLLPI------FIQFGLYSPRIDPDYVGRVRLQKGAS 92
            |..|.|.|.::...|     .::|.:..|.|..      |.::.:.....:.||          |
  Fly    42 GARVTLPCRVINKQG-----TLQWTKDDFGLGTSRDLSGFERYAMVGSDEEGDY----------S 91

Human    93 LQIEGLRVEDQGWYECRVFFLDQHIPEDDFA-NGSWVHLTVNSPPQFQE-TPPAVLEVQELEPVT 155
            |.|..:.::|...|:|:|    ...||...| ..::..|||..||:..: |...|:...|...|.
  Fly    92 LDIYPVMLDDDARYQCQV----SPGPEGQPAIRSTFAGLTVLV
PPEAPKITQGDVIYATEDRKVE 152

Human   156 LRCVA-RGSPLPHVTWKLRGKDLGQGQGQVQVQN-----------------GTLRIRRVERGSSG 202
            :.||: .|.|...:||.       .|.|.|...|                 ..||:...:...:.
  Fly   153 IECVSVGGKPAAEITWI-------DGLGNVLTDNIEYTVIPLPDQRRFTAKSVLRLTPKKEHHNT 210

Human   203 VYTCQASSTEGSATHATQLLV---LGPPVIV-----VP-----------------PKNSTVNASQ 242
            .::|||.:|......:.::.|   ..|.|.|     :|                 ...|.:....
  Fly   211 NFSCQAQNTADRTYR
SAKIRVEVKYAPKVKVNVMGSLPGGAGGSVGGAGGGSVHMSTGSRIVEHS 275

Human   243 DVSLACHAEAYPANLTYSWFQDNINVFHISRLQPRVRILVDGS-----LRLLATQPDDAGCYTCV 302
            .|.|.|.|:|.|:::.|.||.::         :|    ::.|.     :|.:..:..|| ...|.
  Fly   276 QVRLECRADANPSDVRYRWFIND---------EP----IIGGQKTEMVIRNVTRKFHDA-IVKCE 326

Human   303 PSNGLLHPPSASAYLTVLYPAQVTAMPPETPLPIGMPGVIRCPVRANPPLLFVSWTKDGKALQLD 367
            ..|. :.....|..|.:.|.......|......:|....:.|.|.:||....|            
  Fly   327 VQN
S-VGKSEDSETLDISYAPSFRQRPQSMEADVGSVVSLTCEVDSNPQPEIV------------ 378

Human   368 KFPGWSQ-------GTEGSLIIALGNEDALGEYSCTPYNSLGTAGPSPVTRVLLKAPPAFIERPK 425
                |.|       ||..:|..::.||.| |.|.|.. |..|.|..|....|.||..|| |...:
  Fly   379 ----WIQHPSDRVVGTSTNLTFSVSNETA-GRYYCKA-NVPGYAEISADAYVYLKGSPA-IGSQR 436

Human   426 EEYFQEVGRELLIPCSAQGDP-PPVVSWTKVGRGLQGQAQVDSN-----------SSLILRPLTK 478
            .:| ..||....|.|.|...| ...||||..|:.:..::..|.:           |:||:|....
  Fly   437 TQY-GLVGDTARIECFASSVPRARHVSWTFNGQEISSESGHDYSILVDAVPGGVKSTLIIRDSQA 500

Human   479 EAHGHWECSASN------AVARVATSTNVYVLGTSPHVVTNVSVVA------------------- 518
            ..:|.:.|:..|      |..::....:|.:|.|   :|..:||||                   
  Fly   501 YHYGKYNCTVVNDYGNDVAEIQLQAKKSVSLLMT---IVGGISVVAFLLVLTILVVVYIKCKKRT 562

Human   519 -LPK-------------GANVSWEPG------------FDGGYLQ--RFSVWYTP---------- 545
             ||.             |.:...|||            ..|||:.  .:|..|:|          
  Fly   563 KLPPADVISEHQITKNGGVSCKLEPGDRTSNYSDLKVDISGGYVPYGDYSTHYSPPPQYLTTCST 627

Human   546 ------------------LAKRPDRMHHDWVSLAVPVGAAHLLVPGLQPHTQ---YQFSVLAQNK 589
                              |.::..:.||                   |.|||   ...:.|..:.
  Fly   628 KSNGSSTIMQNNHQNQLQLQQQQQQSHH-------------------QHHTQTTTLPMTFLTNSS 673

Human   590 LGS---------------------GPFSEIVLSAPEG----LPTTPA--------APGLPPTEIP 621
            .||                     ...:.:|.|:|.|    ..||.|        .|......:.
  Fly   674 GGSLTGSIIGSREIRQDNGLPSLQSTTASVVSSSPNGSCSNQSTTAATTTTTHVVVPSSMALSVD 738

Human   622 PPLSPPRGLVAVRTPRGVLLHWDPPELV 649
            |..|...|...:|:....||  .||..|
  Fly   739 PRYSAIYGNPYLRSSNSSLL--PPPTAV 764

Known Domains:


GeneSequenceDomainRegion External IDIdentity
IGSF9NP_001128522.1 Ig 24..132 CDD:299845 23/105 (22%)
IG_like 28..110 CDD:214653 17/82 (21%)
I-set 136..223 CDD:254352 21/106 (20%)
Ig 154..220 CDD:143165 17/84 (20%)
Ig_3 226..305 CDD:290638 20/106 (19%)
IG_like 233..319 CDD:214653 19/91 (21%)
Ig 341..404 CDD:299845 18/70 (26%)
IG_like 431..503 CDD:214653 21/90 (23%)
Ig 436..500 CDD:143165 18/82 (22%)
fn3 511..596 CDD:278470 27/184 (15%)
FN3 625..715 CDD:238020 8/26 (31%)
PDZ-binding. {ECO:0000250} 1177..1179
rstNP_001284835.1 IG_like 34..130 CDD:214653 24/107 (22%)
Ig 42..114 CDD:299845 19/91 (21%)
C2-set_2 135..225 CDD:285423 20/97 (21%)
Ig_3 265..329 CDD:290638 16/78 (21%)
I-set 346..420 CDD:254352 22/92 (24%)
Ig 360..425 CDD:299845 22/83 (27%)
Ig5_KIRREL3-like 428..524 CDD:143235 24/98 (24%)
IG_like 435..524 CDD:214653 21/90 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.