DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: IGSF9 and sdk

Sequence 1:NP_001128522.1 Gene:IGSF9 HGNCID:18132 Length:1179 Species:Homo sapiens
Sequence 2:NP_001284756.1 Gene:sdk FlyBaseID:FBgn0021764 Length:2265 Species:Drosophila melanogaster

Alignment Length:1257 Identity:260/1258 (21%)
Similarity:417/1258 (33%) Gaps:400/1258 (32%)


Human    24 PEVV----SVVGRAGESVVLGCDLLPPAGRPPLHVIE--WLRFGFLLPIFIQFGLYSPRIDPDYV 82
            ||::    .|..:.|..||   :|...|...|||.:|  ||:.|..:.   ..|:.....||...
  Fly   261 PEIIVRPQDVKVKVGTGVV---ELQCIANARPLHELETLWLKDGLAVE---TAGVRHTLNDPWNR 319

Human    83 GRVRLQKGASLQIEGLRVEDQGWYECRVFFLDQHIPEDDFANGSWVHLTVNSPPQFQETPPAVLE 147
            ....||..:|         ..|.|.|:|.......|    |..:...|.:..||.| .||.....
  Fly   320 TLALLQANSS---------HSGEYTCQVRLRSGGYP----AVSASARLQILEPPLF-FTPMRAET 370

Human   148 VQEL-EPVTLRCVARGSPLPHVTWKLRGKD----LGQGQGQVQVQNGTLRIRRVERGSSGVYTCQ 207
            ..|. ..|.|.|...|.|.|.|.|....:.    :..|:..:...| ||.|:::....:.::.|.
  Fly   371 FGEFGGQVQLTCDVVGEPTPQVKWFRNAESVDAHIESGRYTLNTDN-TLVIKKLILDDAAMFQCL 434

Human   208 ASSTEGSATHATQLLV--------------------------LG--------------------P 226
            |.:..|..:.:|.|.|                          ||                    .
  Fly   435 AINEAGENSASTWLRVKTKTAKNRVKRLAQPRILRVRASHAGLGSEKGSESGSSDRRKEFRFASA 499

Human   227 PVIVVPPKNSTVNASQDVSLACHAEAYPANLTYSWFQDNINVFHISRLQPRVRILVDGSLRLLAT 291
            |::.:||:|.|....:|.:::|.|...| |...:|..:...:..||   .||:||..|.|.:...
  Fly   500 PIMELPPQNVTALDGKDATISCRAVGSP-NPNITWIYNETQLVDIS---SRVQILESGDLLISNI 560

Human   292 QPDDAGCYTCVPSN--GLLHPPSASAYLTVLYPAQVTAMPPETPLPIGMPGVIRCPVRANPPLLF 354
            :..|||.|.||.:|  |.:   ...|||:||...|:...|.:|.:.:|:...::|.|.::|.:.:
  Fly   561 RSVDAGLYICVRANEAGSV---KGEAYLSVLVRTQIIQPPVDTTVLLGLTATLQCKVSSDPSVPY 622

Human   355 -VSWTKDGKALQLDKFPGWSQGTEGSLIIALGNEDALGEYSCTPYNSLGTAGPSPVTRVLLKAPP 418
             :.|.::|:                               |.||.::                  
  Fly   623 NIDWYREGQ-------------------------------SSTPISN------------------ 638

Human   419 AFIERPKEEYFQEVGRELLIPCSAQGDPPPVVSWTKVGRGLQGQAQVDSNSSLILRPLTKEAHGH 483
                      .|.:|                               |.::..|.::.:.....|.
  Fly   639 ----------SQRIG-------------------------------VQADGQLEIQAVRASDVGS 662

Human   484 WECSASNAVARVATSTNVYVLGTSPHVVTNVSVVALP----KGANVSWEPGFDGG------YLQR 538
            :.|..::.......:..:.|: ..|...:||.|..||    :..||||.|||||.      .:||
  Fly   663 YACVVTSPGGNETRAARLSVI-ELPFPPSNVKVERLPEPQQRSINVSWTPGFDGNSPISKFIIQR 726

Human   539 FSVWYTPLAKRPDRMHHDWVSLAVPVGAAH--LLVPGLQPHTQYQFSVLAQNKLGSGPFSEIVLS 601
            ..|  :.|...||.: .:|::....|.|..  :|:..|:..|.|||.|.|.|::|          
  Fly   727 REV--SELGPVPDPL-LNWITELSNVSADQRWILLENLKAATVYQFRVSAVNRVG---------- 778

Human   602 APEGLPTTPAAPGLPPTEIPPPLSPPRGLV-AVRTPRGVLLHWDPP--ELVPKRLDGYVLEGR-- 661
              ||.|:.|:.....|.|.|.  .||.|.| :.|:...::..|.||  |....::.||:|..|  
  Fly   779 --EGSPSEPSNVVELPQEAPS--GPPVGFVGSARSMSEIITQWQPPLEEHRNGQILGYILRYRLF 839

Human   662 -QGSQGW---EVLDPAVAGTETELLVPGLI--KDVLYEFRLVAFAGSFVSDPSNTANVSTSGLEV 720
             ..:..|   .:.:.|    :...|:..||  ||  |..::.|:....|       .|.|.|.::
  Fly   840 GYNNVPWSYQNITNEA----QRNFLIQELITWKD--YIVQIAAYNNMGV-------GVYTEGSKI 891

Human   721 YPSRTQLPGLLPQPVLAGVVGGVCFLGVAVLVSILAGCL-----------LN---RRRAARRR-- 769
             .::..:|...|..|           .|..:.|..|.|.           :|   :.:|.:||  
  Fly   892 -KTKEGVPEAPPTNV-----------KVEAINSTAARCRWTPPNPQQINGINQGYKIQAWQRRLI 944

Human   770 -------RKRLRQDPPLIFSPTGKSAAPSALGSGSPDSVAKLKL-----QGSPVPSLRQSLLWGD 822
                   .:|::..||.:..|..:..|  .||.....:...:.:     .|..|.|.:.:::..|
  Fly   945 DGEWRDIERRMKTVPPSLIDPLAEQTA--ILGGLEKFTEYNISVLCFTDPGDGVASSQVAVMTMD 1007

Human   823 --PAGTPSPHPDPPSSRGPLPLEPICRGPDGRFVMGPTVAAPQERSGREQAEPRTPAQRLARSFD 885
              |......|.|..|.|....|....|..:| .:.|.||        |.|.:.|...   .:||:
  Fly  1008 DVPDEVTGLHFDDVSDRSVKVLWAPPRASNG-ILTGYTV--------RYQVKDRPDT---LKSFN 1060

Human   886 CSSSSP------------------------SGAPQPLCIED-ISPVAP--PPAAPPSPLPGPGPL 923
            .::...                        ||.|:...|:. :.||.|  |.|...|.:.....:
  Fly  1061 LTADDTELTVNQLQATTHYWFEIVAWTRVGSGIPKTATIQSGVEPVLPHAPTALALSNIEAFSVV 1125

Human   924 LQYLSLPFF------REMNVDGD------WPPLEEPSPAAPPDYMDTRRCPTSSFLRSPETPPVS 976
            ||:  .|.|      .:..|:|.      |..:.|                    :..|:...::
  Fly  1126 LQF--TPGFDGNSSITKWKVEGQTARNMTWFTICE--------------------INDPDAETLT 1168

Human   977 PRESLP----------GAVVGAGATAE--------------PPYT----ALADWTLRERLLP--- 1010
            ....:|          ..|||:...:|              ||:.    |::...||.|.:|   
  Fly  1169 VTGLVPFTQYRLRLSASNVVGSSKPSEATKDFQTIQARPKHPPFNVTVRAMSAQQLRVRWIPLQQ 1233

Human  1011 ----GLLPAAPRGSLTSQSSGRGSASFLRPPSTAPSAGGSYLSPAPGDTSSWASGPERWPRRE-- 1069
                |    .|||...|..      ..::.|.|......|.:.......|......|.|...|  
  Fly  1234 TEWYG----NPRGYNISYK------QLVKTPGTIKYVPRSVVIEDHTANSHVLDSLEEWTLYEVK 1288

Human  1070 ----HVVTVSKRRNTSVDENYE 1087
                :.|..||..:|:|:...|
  Fly  1289 MNACNDVGCSKESDTAVERTRE 1310

Known Domains:


GeneSequenceDomainRegion External IDIdentity
IGSF9NP_001128522.1 Ig 24..132 CDD:299845 28/114 (25%)
IG_like 28..110 CDD:214653 22/84 (26%)
I-set 136..223 CDD:254352 23/92 (25%)
Ig 154..220 CDD:143165 17/70 (24%)
Ig_3 226..305 CDD:290638 25/79 (32%)
IG_like 233..319 CDD:214653 28/88 (32%)
Ig 341..404 CDD:299845 8/64 (13%)
IG_like 431..503 CDD:214653 5/72 (7%)
Ig 436..500 CDD:143165 4/64 (6%)
fn3 511..596 CDD:278470 33/97 (34%)
FN3 625..715 CDD:238020 24/101 (24%)
PDZ-binding. {ECO:0000250} 1177..1179
sdkNP_001284756.1 Ig 71..157 CDD:299845
I-set 72..150 CDD:254352
Ig 172..245 CDD:299845
IG_like 280..356 CDD:214653 22/92 (24%)
Ig 280..343 CDD:299845 19/75 (25%)
IG_like 375..450 CDD:214653 18/76 (24%)
Ig 378..447 CDD:143165 17/70 (24%)
Ig 506..587 CDD:299845 28/88 (32%)
IG_like 506..587 CDD:214653 28/88 (32%)
I-set 592..682 CDD:254352 18/180 (10%)
Ig 595..682 CDD:299845 17/177 (10%)
FN3 686..789 CDD:238020 38/118 (32%)
FN3 798..893 CDD:238020 26/109 (24%)
FN3 901..1005 CDD:238020 20/117 (17%)
fn3 1011..1094 CDD:278470 17/95 (18%)
FN3 1108..1202 CDD:238020 18/116 (16%)
FN3 1210..1308 CDD:238020 24/108 (22%)
fn3 1317..1402 CDD:278470
FN3 1415..1507 CDD:238020
FN3 1513..1608 CDD:238020
fn3 1617..1708 CDD:278470
FN3 1722..1823 CDD:238020
FN3 1828..1920 CDD:238020
FN3 1927..2016 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.