DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: IGSF9 and Dscam4

Sequence 1:NP_001128522.1 Gene:IGSF9 HGNCID:18132 Length:1179 Species:Homo sapiens
Sequence 2:NP_001261571.1 Gene:Dscam4 FlyBaseID:FBgn0263219 Length:1935 Species:Drosophila melanogaster

Alignment Length:1482 Identity:298/1483 (20%)
Similarity:460/1483 (31%) Gaps:555/1483 (37%)


Human    51 PLHVIEWLRFGFLLPIFIQFGLYSPRI----DPDYVGRVRLQKGASLQIEGLRVEDQGWYECRVF 111
            |:|.:.||..|  .||     |...|:    ||           ..|.|:.::.||.|.|:|   
  Fly   357 PVHDVNWLHDG--KPI-----LRDNRVEILTDP-----------PRLIIKKVQKEDPGMYQC--- 400

Human   112 FLDQHIPEDDFANGSWVHLTVNSPPQFQETPPAVL---EVQELEP---VTLRCVARGSPLPHVTW 170
                      |.:..|..:...:..|..:..|.:|   ..|.|:|   |:|:|||.|:|||..||
  Fly   401 ----------FVSNEWEQIQSTAELQL
GDASPELLYWFSEQTLQPGPTVSLKCVATGNPLPQFTW 455

Human   171 KLRGKDLGQGQ----GQ-VQVQNGTL---RIRRVERGSSGVYTCQASSTEGSATHATQLLVLGPP 227
            .|.|..:....    || |.:.:..:   .|..|:....|.|||.|.:..|..:|:.::.:.|.|
  Fly   456 SLDGFPIPDSSRFLVGQYVTIHDDVISHVNISNVKEEDGGEYTCTAQNAIGKVSHSAKVNI
YGLP 520

Human   228 VIVVPPKNSTVNASQDVSLACHAEAYPANLTYSWFQDNINVFHISRLQPRVRILVDGSLRLLATQ 292
            .|...||.:.::.| |:.:.|....||.:..: |.:|. ....|:|   |.|...:|:|.:...|
  Fly   521 YIREMPKITGISGS-DLIVKCPVAGYPIDKIH-WERDG-QTLPINR---RQRAYNNGTLIIEQLQ 579

Human   293 P-DDAGCYTCVPSNGLLHPPSASAYLTVLYPAQVTAMPPET-PLPIGMPGVIRCPV-RANPPLLF 354
            . :|||.|||:..|........:..:.||.|.::..:...| .|..||...|.|.: ..:.|:.|
  Fly   580 RLEDAGTYTCMAQNKQKQTSRRNVEIQVLVPPKIMPIQAMTNMLREGMRAAISCQILEGDLPVSF 644

Human   355 VSWTKDGKAL---------QLDKFPGWSQGTEGSLIIALGNEDALGEYSCTPYNSLGTAG-PSPV 409
             .|.::||.|         :||::       ..||:|...:.|..|.|:|...|..||.. ..|:
  Fly   645 -RWERNGKPLIGTGNEVFRRLDEY-------SASLVIEHISSDHSGNYTCIASNVAGTERFTVPL 701

Human   410 TRVLLKAPPAFIERPKEEYFQEVGRELLIPCSAQGDPPPVVSWTKVGRGLQGQ---------AQV 465
            |   :..||.:|..||:...| .|.::|:.|.:.|.|.|.::|.|......|:         .|:
  Fly   702 T---VNVPPKWILEPKDSSAQ-AGADVLLHCQSSGYPTPTITWKKAIGPTPGEYKDFLYEPTVQL 762

Human   466 DSNSSLILRPLTKEAHGHWECSASNAVARVATSTNVYVLGTSPHVVTNVSVVALPKGANV----- 525
            ..|.::..:.::||:.||:.|.|.|.:....:......:....|..|....:::.||..|     
  Fly   763 FPNGTIFFKKISKESQGHFLCEAKNNIGSGVSKVIFLKVNVPAHFQTKTKQISVAKGKQVHVQCN 827

Human   526 ---------SW---------EPGFDGGYLQRFSV------------------------------- 541
                     .|         :...|..|..|..|                               
  Fly   828 VQGDNPIDFKWKIQATQQYLDESLDSRYTIRDQVLDDGMVSELGISHTYRQDTGIYICQASNAFG 892

Human   542 ---------------------------------WYTPLA-KRPDRMHHDWVSLAVPV--GAAHLL 570
                                             |..|.| ..|...:|.:......:  .|.||.
  Fly   893 QDEMSIQLIVQEVPEQPKNLRINSQQSRSLQLTWSQPFAGNSPIEEYHIYYKQISDIWQNAEHLT 957

Human   571 VPG---------LQPHTQYQFSVLAQNKLGSGPFSEIVL-----SAPEGLPTTPAAPGLPPTEI- 620
            :.|         |:|...|...:.|:||||:..|||:|.     ..|.|.|....|.....||| 
  Fly   958 IAGAQTVINIQQLRPAKAYHIRMSAENKLGASEFSEVVQVTTLEEVPSGPPLAVRAEPKSSTEIF 1022

Human   621 ----------------------------------------------------------------- 620
                                                                             
  Fly  1023 VTWDAPERDHWNGILLGYYVGYQMSLTPEDKEVNPTQGFSFKTVEVRSHFGGETVLANLNKFTQY 1087

Human   621 -------------PP------------PLSPPRGLVAVRTPR-------GVLLHWDPPELVPKRL 653
                         ||            |.|||      .:|:       .:.:.|.||:      
  Fly  1088 HVIVQAYTSQGSGPPSKEIAVQTMEDVPSSPP------ESPQCDVLGSTSIYITWSPPD------ 1140

Human   654 DGYVLEGRQGS-QGWEVL----------DP-AVAGTETELLVPGLIKDVLYEFRLVAFAGSFVSD 706
                ::|:.|. :|::|.          || .|..|...:.:..|.|...|...::|:  :.|.|
  Fly  1141 ----IDGQNGKIKGYKVFYISVDELYETDPEVVKSTNQYVTIENLRKYTNYTVWVLAY--TKVGD 1199

Human   707 PSNTANVSTSGLEVYPSRTQ----LP--------GLLPQPVLAGVVGGVCFLGVAVLVSILAGCL 759
            ...|........|..||..|    :|        ..||..:..|.:.|..|     .:|:|.|  
  Fly  1200 GMKTKPFYCRTHEDVPSAPQAIKAIPASSSKIIISWLPPDLPNGDITGYTF-----YMSMLEG-- 1257

Human   760 LNRRRAARRRRKRLRQDPPLIFSP---------TGKSA-------APSALGSGSPDSVAKLKLQG 808
             .|.....:|          :..|         |.:||       |.:.:|.|....|..:. ..
  Fly  1258 -GREEGTHKR----------LLGPFVEMHETVRTQESATYQFWLTASTKMGEGEKTQVVTVP-PN 1310

Human   809 SPVP----SLRQSLL--WGD-------PAGTPSP--------HPDPPSSR------GPLPLEPIC 846
            :.||    |..|.::  |.:       ..|.|:|        |....|:|      |.|.::. |
  Fly  1311 NKVPARIVSFSQRIVTPWKEHLELPCRKVGAPAPVTIWRQDGHNMETSARKTIAKNGTLYMKE-C 1374

Human   847 RGPDGRFVMGPTVAAPQERSGREQAEPRTPAQRLARSFDCSSSSPSGAPQPLCIEDISPVAPPPA 911
            :..|                              |.::.||..:..|..:  .:.:| .|..||.
  Fly  1375 QASD------------------------------AGNYTCSVENTWGKDE--IVYNI-VVKVPPE 1406

Human   912 APPSPL----------------PGPGPLLQYLSLPFFREMNVDGDWPPLEEPSPAAPPDYMDTRR 960
            ||...:                .|..|:|.|: :.:.|:   :|||..|:..|... ...:....
  Fly  1407 APNLTVINAYTDSLLLEWMDNSHGGSPILGYV-INYKRD---NGDWEELQVDSKTT-SHLLTNLW 1466

Human   961 CPTSSFLRSPETPPVSPRESLPGAVVGAGATAEPPYTALADWTLRERLLPGLLPAAPRGS--LTS 1023
            |.|...|.......:.  ..||..:|.:.....|                   |..|:.|  :|:
  Fly  1467 CGTRYQLYITAYNKIG--TGLPCDIVNSYTKGNP-------------------PVQPKHSQMITN 1510

Human  1024 QSS---------GRGSASFLRPPSTAPSAGGSYL---SPAPGDTSSWASGPERWPRREHVVTVSK 1076
            .|:         |.|....|            |.   |...| .||||......|..|.:.||| 
  Fly  1511 NSTSVTCWLDSWGDGGCGIL------------YFMIESRVYG-RSSWAVVSNHIPPTERIYTVS- 1561

Human  1077 RRNTSVDENYEWDSEFPGDMELLETLHLGLASSRLRPEAEPELGVKT--------PEEGCLLNTA 1133
                         ...||            ...:|:..|....|..|        ..:|.:.|..
  Fly  1562 -------------DLVPG------------TKYQLKVTAHNNAGSTTAIYNFTTLSTQGVIYNND 1601

Human  1134 HVTGPEARCA----------------------ALREEFLAFRRRRDATRARL 1163
            |.| |.:..:                      ||....|..|:|:.|::|||
  Fly  1602 HST-PVSHLSDLPFYANFKLLLPICFSLLMLLALIGAALFLRKRKLASQARL 1652

Known Domains:


GeneSequenceDomainRegion External IDIdentity
IGSF9NP_001128522.1 Ig 24..132 CDD:299845 20/85 (24%)
IG_like 28..110 CDD:214653 18/63 (29%)
I-set 136..223 CDD:254352 31/101 (31%)
Ig 154..220 CDD:143165 25/74 (34%)
Ig_3 226..305 CDD:290638 24/80 (30%)
IG_like 233..319 CDD:214653 23/87 (26%)
Ig 341..404 CDD:299845 20/73 (27%)
IG_like 431..503 CDD:214653 18/81 (22%)
Ig 436..500 CDD:143165 17/73 (23%)
fn3 511..596 CDD:278470 27/184 (15%)
FN3 625..715 CDD:238020 22/109 (20%)
PDZ-binding. {ECO:0000250} 1177..1179
Dscam4NP_001261571.1 Ig 31..118 CDD:299845
IG 135..209 CDD:214652
IG_like 246..326 CDD:214653
Ig 254..323 CDD:143165
I-set 335..416 CDD:254352 20/90 (22%)
Ig 336..417 CDD:299845 21/91 (23%)
IG_like 429..516 CDD:214653 28/87 (32%)
Ig 439..513 CDD:143165 25/74 (34%)
IG_like 526..607 CDD:214653 23/87 (26%)
IGc2 532..594 CDD:197706 21/68 (31%)
IG 624..703 CDD:214652 24/90 (27%)
Ig 631..699 CDD:143165 20/76 (26%)
I-set 707..801 CDD:254352 23/95 (24%)
Ig 724..801 CDD:299845 17/77 (22%)
I-set 806..902 CDD:254352 10/96 (10%)
Ig 819..909 CDD:299845 7/90 (8%)
FN3 906..999 CDD:238020 21/93 (23%)
FN3 1006..1110 CDD:238020 8/104 (8%)
fn3 1117..1203 CDD:278470 21/104 (20%)
FN3 1215..1307 CDD:238020 22/110 (20%)
Ig 1313..1394 CDD:299845 19/112 (17%)
FN3 1405..1494 CDD:238020 19/96 (20%)
FN3 1499..1580 CDD:238020 24/120 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.