DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IGSF9 and Dscam4

DIOPT Version :9

Sequence 1:NP_001128522.1 Gene:IGSF9 / 57549 HGNCID:18132 Length:1179 Species:Homo sapiens
Sequence 2:NP_001261571.1 Gene:Dscam4 / 2769008 FlyBaseID:FBgn0263219 Length:1935 Species:Drosophila melanogaster


Alignment Length:1482 Identity:298/1482 - (20%)
Similarity:460/1482 - (31%) Gaps:555/1482 - (37%)


- Green bases have known domain annotations that are detailed below.


Human    51 PLHVIEWLRFGFLLPIFIQFGLYSPRI----DPDYVGRVRLQKGASLQIEGLRVEDQGWYECRVF 111
            |:|.:.||..|  .||     |...|:    ||           ..|.|:.::.||.|.|:|   
  Fly   357 PVHDVNWLHDG--KPI-----LRDNRVEILTDP-----------PRLIIKKVQKEDPGMYQC--- 400

Human   112 FLDQHIPEDDFANGSWVHLTVNSPPQFQETPPAVL---EVQELEP---VTLRCVARGSPLPHVTW 170
                      |.:..|..:...:..|..:..|.:|   ..|.|:|   |:|:|||.|:|||..||
  Fly   401 ----------FVSNEWEQIQSTAELQL
GDASPELLYWFSEQTLQPGPTVSLKCVATGNPLPQFTW 455

Human   171 KLRGKDLGQGQ----GQ-VQVQNGTL---RIRRVERGSSGVYTCQASSTEGSATHATQLLVLGPP 227
            .|.|..:....    || |.:.:..:   .|..|:....|.|||.|.:..|..:|:.::.:.|.|
  Fly   456 SLDGFPIPDSSRFLVGQYVTIHDDVISHVNISNVKEEDGGEYTCTAQNAIGKVSHSAKVNI
YGLP 520

Human   228 VIVVPPKNSTVNASQDVSLACHAEAYPANLTYSWFQDNINVFHISRLQPRVRILVDGSLRLLATQ 292
            .|...||.:.::.| |:.:.|....||.:..: |.:|. ....|:|   |.|...:|:|.:...|
  Fly   521 YIREMPKITGISGS-DLIVKCPVAGYPIDKIH-WERDG-QTLPINR---RQRAYNNGTLIIEQLQ 579

Human   293 P-DDAGCYTCVPSNGLLHPPSASAYLTVLYPAQVTAMPPET-PLPIGMPGVIRCPV-RANPPLLF 354
            . :|||.|||:..|........:..:.||.|.::..:...| .|..||...|.|.: ..:.|:.|
  Fly   580 RLEDAGTYTCMAQNKQKQTSRRNVEIQV
LVPPKIMPIQAMTNMLREGMRAAISCQILEGDLPVSF 644

Human   355 VSWTKDGKAL---------QLDKFPGWSQGTEGSLIIALGNEDALGEYSCTPYNSLGTAG-PSPV 409
             .|.::||.|         :||::       ..||:|...:.|..|.|:|...|..||.. ..|:
  Fly   645 -RWERNGKPLIGTGNEVFRRLDEY-------SASLVIEHISSDHSGNYTCIASNVAGTERFTVPL 701

Human   410 TRVLLKAPPAFIERPKEEYFQEVGRELLIPCSAQGDPPPVVSWTKVGRGLQGQ---------AQV 465
            |   :..||.:|..||:...| .|.::|:.|.:.|.|.|.::|.|......|:         .|:
  Fly   702 T---VNVPPKWILEPKDSSAQ-AGADVLLHCQSSGYPTPTITWKKAIGPTPGEYKDFLYEPTVQL 762

Human   466 DSNSSLILRPLTKEAHGHWECSASNAVARVATSTNVYVLGTSPHVVTNVSVVALPKGANV----- 525
            ..|.::..:.::||:.||:.|.|.|.:....:......:....|..|....:::.||..|     
  Fly   763 FPNGTIFFKKISKESQGHFLCEAKNNIGSGVSKVIFLKVNVPAHFQTKTKQISVAKGKQVHVQCN 827

Human   526 ---------SW---------EPGFDGGYLQRFSV------------------------------- 541
                     .|         :...|..|..|..|                               
  Fly   828 VQGDNPIDFKWKIQATQQYLDESLDSRYTIRDQVLDDGMVSELGISHTYRQDTGIYICQASNAFG 892

Human   542 ---------------------------------WYTPLA-KRPDRMHHDWVSLAVPV--GAAHLL 570
                                             |..|.| ..|...:|.:......:  .|.||.
  Fly   893 QDEMSIQLIVQEVPEQPKNLRINSQQSRSLQLTWSQPFAGNSPIEEYHIYYKQISDIWQNAEHLT 957

Human   571 VPG---------LQPHTQYQFSVLAQNKLGSGPFSEIVL-----SAPEGLPTTPAAPGLPPTEI- 620
            :.|         |:|...|...:.|:||||:..|||:|.     ..|.|.|....|.....||| 
  Fly   958 IAGAQTVINIQQLRPAKAYHIRMSAENKLGASEFSEVVQVTTLEEVPSGPPLAVRAEPKSSTEIF 1022

Human   621 ----------------------------------------------------------------- 620
                                                                             
  Fly  1023 VTWDAPERDHWNGILLGYYVGYQMSLTPEDKEVNPTQGFSFKTVEVRSHFGGETVLANLNKFTQY 1087

Human   621 -------------PP------------PLSPPRGLVAVRTPR-------GVLLHWDPPELVPKRL 653
                         ||            |.|||      .:|:       .:.:.|.||:      
  Fly  1088 HVIVQAYTSQGSGPPSKEIAVQTMEDVPSSPP------ESPQCDVLGSTSIYITWSPPD------ 1140

Human   654 DGYVLEGRQGS-QGWEVL----------DP-AVAGTETELLVPGLIKDVLYEFRLVAFAGSFVSD 706
                ::|:.|. :|::|.          || .|..|...:.:..|.|...|...::|:  :.|.|
  Fly  1141 ----IDGQNGKIKGYKVFYISVDELYETDPEVVKSTNQYVTIENLRKYTNYTVWVLAY--TKVGD 1199

Human   707 PSNTANVSTSGLEVYPSRTQ----LP--------GLLPQPVLAGVVGGVCFLGVAVLVSILAGCL 759
            ...|........|..||..|    :|        ..||..:..|.:.|..|     .:|:|.|  
  Fly  1200 GMKTKPFYCRTHEDVPSAPQAIKAIPASSSKIIISWLPPDLPNGDITGYTF-----YMSMLEG-- 1257

Human   760 LNRRRAARRRRKRLRQDPPLIFSP---------TGKSA-------APSALGSGSPDSVAKLKLQG 808
             .|.....:|          :..|         |.:||       |.:.:|.|....|..:. ..
  Fly  1258 -GREEGTHKR----------LLGPFVEMHETVRTQESATYQFWLTASTKMGEGEKTQVVTVP-PN 1310

Human   809 SPVP----SLRQSLL--WGD-------PAGTPSP--------HPDPPSSR------GPLPLEPIC 846
            :.||    |..|.::  |.:       ..|.|:|        |....|:|      |.|.::. |
  Fly  1311 NKVPARIVSFSQRIVTPWKEHLELPCRKVGAPAPVTIWRQDGHNMETSARKTIAKNGTLYMKE-C 1374

Human   847 RGPDGRFVMGPTVAAPQERSGREQAEPRTPAQRLARSFDCSSSSPSGAPQPLCIEDISPVAPPPA 911
            :..|                              |.::.||..:..|..:  .:.:| .|..||.
  Fly  1375 QASD------------------------------AGNYTCSVENTWGKDE--IVYNI-VVKVPPE 1406

Human   912 APPSPL----------------PGPGPLLQYLSLPFFREMNVDGDWPPLEEPSPAAPPDYMDTRR 960
            ||...:                .|..|:|.|: :.:.|:   :|||..|:..|... ...:....
  Fly  1407 APNLTVINAYTDSLLLEWMDNSHGGSPILGYV-INYKRD---NGDWEELQVDSKTT-SHLLTNLW 1466

Human   961 CPTSSFLRSPETPPVSPRESLPGAVVGAGATAEPPYTALADWTLRERLLPGLLPAAPRGS--LTS 1023
            |.|...|.......:.  ..||..:|.:.....|                   |..|:.|  :|:
  Fly  1467 CGTRYQLYITAYNKIG--TGLPCDIVNSYTKGNP-------------------PVQPKHSQMITN 1510

Human  1024 QSS---------GRGSASFLRPPSTAPSAGGSYL---SPAPGDTSSWASGPERWPRREHVVTVSK 1076
            .|:         |.|....|            |.   |...| .||||......|..|.:.||| 
  Fly  1511 NSTSVTCWLDSWGDGGCGIL------------YFMIESRVYG-RSSWAVVSNHIPPTERIYTVS- 1561

Human  1077 RRNTSVDENYEWDSEFPGDMELLETLHLGLASSRLRPEAEPELGVKT--------PEEGCLLNTA 1133
                         ...||            ...:|:..|....|..|        ..:|.:.|..
  Fly  1562 -------------DLVPG------------TKYQLKVTAHNNAGSTTAIYNFTTLSTQGVIYNND 1601

Human  1134 HVTGPEARCA----------------------ALREEFLAFRRRRDATRARL 1163
            |.| |.:..:                      ||....|..|:|:.|::|||
  Fly  1602 HST-PVSHLSDLPFYANFKLLLPICFSLLMLLALIGAALFLRKRKLASQARL 1652

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IGSF9NP_001128522.1 Ig 24..132 CDD:299845 20/84 (24%)
IG_like 28..110 CDD:214653 18/62 (29%)
I-set 136..223 CDD:254352 31/100 (31%)
Ig 154..220 CDD:143165 25/73 (34%)
Ig_3 226..305 CDD:290638 24/79 (30%)
IG_like 233..319 CDD:214653 23/86 (27%)
Ig 341..404 CDD:299845 19/72 (26%)
IG_like 431..503 CDD:214653 18/80 (23%)
Ig 436..500 CDD:143165 17/72 (24%)
fn3 511..596 CDD:278470 26/183 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 606..626 8/110 (7%)
FN3 625..715 CDD:238020 22/108 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 767..919 34/210 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 940..988 10/47 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1015..1079 19/77 (25%)
PDZ-binding. /evidence=ECO:0000250 1177..1179
Dscam4NP_001261571.1 Ig 31..124 CDD:416386
Ig strand A 32..35 CDD:409353
Ig strand A' 41..45 CDD:409353
Ig strand B 48..57 CDD:409353
Ig strand D 75..78 CDD:409353
Ig strand E 83..88 CDD:409353
Ig strand F 101..109 CDD:409353
Ig strand G 112..124 CDD:409353
Ig 235..326 CDD:416386
Ig strand A 235..238 CDD:409353
Ig strand A' 244..248 CDD:409353
Ig strand B 251..258 CDD:409353
Ig strand C 266..271 CDD:409353
Ig strand C' 276..279 CDD:409353
Ig strand D 285..289 CDD:409353
Ig strand E 292..298 CDD:409353
Ig strand F 305..313 CDD:409353
Ig strand G 316..326 CDD:409353
IgC2_3_Dscam 329..417 CDD:409549 20/90 (22%)
Ig strand B 347..351 CDD:409549
Ig strand C 360..364 CDD:409549 0/3 (0%)
Ig strand E 383..387 CDD:409549 1/3 (33%)
Ig strand F 397..402 CDD:409549 2/17 (12%)
Ig strand G 410..413 CDD:409549 0/2 (0%)
IgI_4_Dscam 422..516 CDD:409548 30/93 (32%)
Ig strand B 439..443 CDD:409548 2/3 (67%)
Ig strand C 452..456 CDD:409548 1/3 (33%)
Ig strand E 482..486 CDD:409548 0/3 (0%)
Ig strand F 496..501 CDD:409548 3/4 (75%)
Ig strand G 509..512 CDD:409548 1/2 (50%)
IgI_5_Dscam 520..607 CDD:409550 25/92 (27%)
Ig strand B 536..540 CDD:409550 0/3 (0%)
Ig strand C 549..553 CDD:409550 0/4 (0%)
Ig strand E 571..575 CDD:409550 2/3 (67%)
Ig strand F 586..591 CDD:409550 3/4 (75%)
Ig strand G 600..603 CDD:409550 0/2 (0%)
Ig 610..703 CDD:416386 27/103 (26%)
Ig strand A 611..613 CDD:409353 0/1 (0%)
Ig strand A' 620..624 CDD:409353 1/3 (33%)
Ig strand B 627..636 CDD:409353 3/8 (38%)
Ig strand C 641..648 CDD:409353 3/7 (43%)
Ig strand C' 650..652 CDD:409353 1/1 (100%)
Ig strand D 659..664 CDD:409353 0/4 (0%)
Ig strand E 668..675 CDD:409353 3/6 (50%)
Ig strand F 682..690 CDD:409353 3/7 (43%)
Ig strand G 693..702 CDD:409353 3/8 (38%)
IgI_7_Dscam 706..801 CDD:409546 24/95 (25%)
Ig strand B 724..728 CDD:409546 1/3 (33%)
Ig strand C 737..741 CDD:409546 0/3 (0%)
Ig strand E 766..770 CDD:409546 0/3 (0%)
Ig strand F 780..785 CDD:409546 2/4 (50%)
Ig strand G 794..797 CDD:409546 0/2 (0%)
Ig 818..904 CDD:416386 8/85 (9%)
putative Ig strand B 820..827 CDD:409353 1/6 (17%)
putative Ig strand C 835..841 CDD:409353 1/5 (20%)
putative Ig strand C' 853..856 CDD:409353 0/2 (0%)
putative Ig strand D 862..866 CDD:409353 0/3 (0%)
putative Ig strand E 868..874 CDD:409353 0/5 (0%)
putative Ig strand F 881..889 CDD:409353 0/7 (0%)
putative Ig strand G 892..902 CDD:409353 0/9 (0%)
FN3 906..999 CDD:238020 21/92 (23%)
FN3 1006..1110 CDD:238020 8/103 (8%)
fn3 1117..1203 CDD:394996 21/103 (20%)
FN3 1215..1307 CDD:238020 22/109 (20%)
Ig <1334..1401 CDD:416386 15/100 (15%)
Ig strand C 1345..1349 CDD:409353 0/3 (0%)
Ig strand D 1363..1366 CDD:409353 0/2 (0%)
Ig strand E 1367..1372 CDD:409353 2/4 (50%)
Ig strand F 1380..1388 CDD:409353 2/7 (29%)
Ig strand G 1394..1401 CDD:409353 1/9 (11%)
FN3 1405..1494 CDD:238020 19/95 (20%)
FN3 1499..1580 CDD:238020 24/119 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.