| Sequence 1: | NP_001128522.1 | Gene: | IGSF9 / 57549 | HGNCID: | 18132 | Length: | 1179 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001096850.2 | Gene: | dpr7 / 2768865 | FlyBaseID: | FBgn0053481 | Length: | 312 | Species: | Drosophila melanogaster |
| Alignment Length: | 278 | Identity: | 66/278 - (23%) |
|---|---|---|---|
| Similarity: | 105/278 - (37%) | Gaps: | 72/278 - (25%) |
- Green bases have known domain annotations that are detailed below.
|
Human 130 LTVNSPPQFQETPPAVLEVQELEPVTLRCVARGSPLPHVTWKLRGKDLG---------QGQGQVQ 185
Human 186 V------QNGTLRIRRVERGSSGVYTCQASSTEGSA-------------------------THAT 219
Human 220 QLLVLGPPVIVVPPKNSTVNASQDVSLACHAEAYPANLTYSWFQDNINVFHISRLQPRVRIL--- 281
Human 282 --VDGSLRLLATQPD--DAGCYTCVPSNGLLHPPSASAYLTVLYPAQVTAMPPETPLPI----GM 338
Human 339 PGVIRCPVRANPPLLFVS 356 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| IGSF9 | NP_001128522.1 | Ig | 24..132 | CDD:299845 | 1/1 (100%) |
| IG_like | 28..110 | CDD:214653 | |||
| I-set | 136..223 | CDD:254352 | 25/126 (20%) | ||
| Ig | 154..220 | CDD:143165 | 21/105 (20%) | ||
| Ig_3 | 226..305 | CDD:290638 | 21/85 (25%) | ||
| IG_like | 233..319 | CDD:214653 | 23/92 (25%) | ||
| Ig | 341..404 | CDD:299845 | 5/16 (31%) | ||
| IG_like | 431..503 | CDD:214653 | |||
| Ig | 436..500 | CDD:143165 | |||
| fn3 | 511..596 | CDD:278470 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 606..626 | ||||
| FN3 | 625..715 | CDD:238020 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 767..919 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 940..988 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1015..1079 | ||||
| PDZ-binding. /evidence=ECO:0000250 | 1177..1179 | ||||
| dpr7 | NP_001096850.2 | V-set | 56..145 | CDD:284989 | 22/90 (24%) |
| IG_like | 58..140 | CDD:214653 | 20/83 (24%) | ||
| IG_like | 179..265 | CDD:214653 | 25/99 (25%) | ||
| Ig | 187..257 | CDD:299845 | 21/79 (27%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||